Data / Carriers / Hazardous materials carriers / Virginia
Hazardous materials carriers carriers in Virginia: 572 carriers with 5+ trucks
FMCSA lists 572 active carriers in Virginia with 5 or more power units that report hazardous materials carriers, 173 of them with 20 or more, running 48,571 power units with 43,290 drivers. Their vehicles went out of service in 15.1% of 15,621 vehicle inspections from November 7, 2024 to November 7, 2026, against 22.9% for all carriers.
SpecStream is the live web data engine for teams and agents. It reads the carrier register, roadside inspections, crashes and operating authority that FMCSA publishes, and this page is that reading. Ask for the carriers you sell to or insure by state, city, cargo or fleet size, and new inspections, crashes and authority changes arrive in your sheet, CRM, Slack or agent as FMCSA posts them.
- Carriers with 5+ power units
- 572
- With 20+ power units
- 173
- Power units
- 48,571
- Drivers
- 43,290
- Inspections
- 24,781
- Crashes involving these carriers, wherever they happened
- 1,714
- Vehicle out of service rate
- 15.1% (7.8 points below the national rate, national 22.9%)
Largest of these carriers in Virginia
Ranked by power units. Counts cover November 7, 2024 to November 7, 2026.
| Carrier | City | Power units | Drivers | Inspections | Vehicle out of service | Crashes |
|---|---|---|---|---|---|---|
| Estes Express Lines | Richmond | 9,805 | 8,821 | 4,640 | 16.2% | 595 |
| Ferguson Enterprises LLC | Newport News | 8,238 | 3,871 | 2,378 | 10.2% | 66 |
| Performance Transportation LLC | Richmond | 6,340 | 7,480 | 3,227 | 12.8% | 226 |
| Tforce Freight Inc | Henrico | 4,155 | 4,379 | 3,546 | 16.7% | 185 |
| Beacon Sales Acquisition Inc | Herndon | 2,367 | 1,855 | 1,536 | 11.3% | 55 |
| Vistar Transportation LLC | Richmond | 995 | 644 | 571 | 13.5% | 27 |
| Virginia Electric & Power Co | Richmond | 894 | 1,653 | 10 | Not listed | 7 |
| Carter Machinery Company Inc | Salem | 713 | 606 | 204 | 6.7% | 14 |
| Carmax Auto Superstores Inc | Richmond | 654 | 681 | 281 | 15.7% | 16 |
| Southern States Co-Operative Inc | Richmond | 469 | 369 | 108 | 14.3% | 14 |
| Thompson Trucking Inc | Concord | 438 | 324 | 471 | 25% | 35 |
| Big E Transportation LLC | Richmond | 380 | 383 | 209 | 37.2% | 20 |
| Professional Automotive Relocation Services LLC | Gainesville | 336 | 81 | 2 | Not listed | 0 |
| Mckesson Medical Surgical Inc | Richmond | 315 | 492 | 247 | 4.7% | 9 |
| Foster Fuels LLC | Brookneal | 261 | 210 | 214 | 8.2% | 4 |
| Service Transfer Inc | Chesapeake | 240 | 217 | 448 | 20.6% | 20 |
| Richardson-Wayland-Ferreira LLC | Roanoke | 200 | 185 | 8 | 40% | 0 |
| Superior Paving Corporation | Gainesville | 200 | 162 | 5 | Not listed | 2 |
| Hot-Rock Haulers LLC | South Boston | 200 | 132 | 202 | 16.7% | 14 |
| M Pittman Enterprises LC | Manassas | 200 | 112 | 302 | 10.1% | 13 |
| Carpenter Co | Richmond | 155 | 139 | 204 | 12.3% | 6 |
| Houff Corporation | Mount Crawford | 143 | 75 | 20 | 30.8% | 1 |
| Veolia WTS Services USA Inc | Norfolk | 138 | 107 | 104 | 5.5% | 2 |
| Whitehurst Paving Co Inc | Richmond | 138 | 52 | 24 | 35.7% | 4 |
| R Wendell Presgrave Inc | Fairfax | 130 | 110 | 1 | Not listed | 0 |
| Ibv LLC | Portsmouth | 129 | 118 | 198 | 37.6% | 6 |
| James River Carriers LLC | Richmond | 129 | 112 | 174 | 35.7% | 9 |
| Davenport Energy LLC | Chatham | 127 | 94 | 79 | 6.7% | 4 |
| Payne Inc | Fredericksburg | 126 | 113 | 155 | 18.7% | 12 |
| Aero Global Logistics | Winchester | 117 | 129 | 169 | 8.9% | 10 |
| Houff Transfer Incorporated | Weyers Cave | 117 | 111 | 57 | 16% | 9 |
| Parker Oil Company Inc | South Hill | 116 | 115 | 107 | 4% | 6 |
| Direct Services Inc | Springfield | 110 | 98 | 34 | 10.5% | 0 |
| Branscome Operating LLC | Williamsburg | 108 | 70 | 36 | 14.3% | 5 |
| GPM Transportation Company LLC | Richmond | 106 | 109 | 159 | 10.5% | 4 |
| Shirley Contracting Company LLC | Lorton | 105 | 111 | 5 | Not listed | 3 |
| W-L Construction & Paving Inc | Chilhowie | 102 | 120 | 49 | 11.1% | 3 |
| Allan Myers VA Inc | Williamsburg | 99 | 251 | 53 | 0% | 13 |
| Tree Care of New York LLC | Norfolk | 96 | 143 | 17 | 37.5% | 1 |
| Prolift Rigging Company LLC | Rustburg | 92 | 91 | 28 | 30.8% | 4 |
| Branch Civil Inc | Roanoke | 90 | 87 | 48 | 10% | 6 |
| W E L Inc | Concord | 90 | 33 | 19 | 14.3% | 1 |
| Gerdau Ameristeel US Inc | Roanoke | 89 | 65 | 64 | 42.5% | 6 |
| Hillcrest Transportation Inc | South Prince George | 88 | 76 | 79 | 5.9% | 7 |
| Brothers Paving and Concrete | Bristow | 85 | 85 | 5 | Not listed | 0 |
| LCS Site Services LLC | Woodbridge | 82 | 59 | 7 | Not listed | 4 |
| Crossroads Fuel Service Inc | Chesapeake | 82 | 40 | 48 | 11.8% | 0 |
| Blumont Energy Corporation | Martinsville | 81 | 26 | 13 | 38.5% | 1 |
| Sweetie Boy Transportation LLC | Richmond | 80 | 77 | 44 | 4.2% | 9 |
| Mecklenburg Electric Cooperative | Chase City | 76 | 76 | 0 | Not listed | 0 |
| Raytheon Company | Arlington | 75 | 94 | 1 | Not listed | 0 |
| Arcet Equipment Company | Richmond | 74 | 181 | 56 | 7.4% | 1 |
| HWS LLC | Falls Church | 73 | 66 | 29 | 64.3% | 8 |
| Handy Distribution LLC. | Lynchburg | 72 | 72 | 82 | 15% | 3 |
| Holtzman Propane Delivery LLC | MT Jackson | 68 | 52 | 89 | 9% | 3 |
| Tiger Fuel Company | Charlottesville | 67 | 78 | 72 | 10% | 5 |
| R O Harrell Inc | South Boston | 65 | 38 | 80 | 16.3% | 4 |
| Noah Horn Well Drilling Inc | Oakwood | 64 | 60 | 3 | Not listed | 1 |
| Taylor's Construction LLC | Chilhowie | 62 | 117 | 22 | 43.8% | 0 |
| A&a Transfer LLC | Chantilly | 62 | 90 | 9 | Not listed | 1 |
| Eurovia Atlantic Coast LLC | Chantilly | 61 | 303 | 180 | 11.7% | 9 |
| Stuart M Perry Inc | Winchester | 61 | 56 | 9 | 50% | 0 |
| S and S Transporters Inc | Woodlawn | 60 | 75 | 135 | 8.1% | 4 |
| S B Cox Inc | Richmond | 60 | 53 | 8 | Not listed | 1 |
| VSL Electrical Signing Lighting LLC | Manassas | 57 | 72 | 2 | Not listed | 0 |
| C W Strittmatter Inc | Manassas Park | 57 | 56 | 59 | 15.6% | 5 |
| Al's Towing & Storage Inc | Arlington | 55 | 24 | 6 | 33.3% | 1 |
| USA Logistics and Leasing LLC | Chester | 54 | 25 | 0 | Not listed | 0 |
| Middlesex Bottled Gas Inc | Hartfield | 53 | 50 | 0 | Not listed | 0 |
| Hot-Z Food Marts Inc | Salem | 53 | 44 | 56 | 12% | 4 |
| United Freight Service Inc | Petersburg | 52 | 61 | 80 | 22.6% | 1 |
| Sonic Transport LLC | Hampton | 52 | 15 | 13 | 25% | 1 |
| Superior Trucking Corporation | Gainesville | 51 | 51 | 26 | Not listed | 2 |
| Akima Logistics Services LLC | Herndon | 51 | 40 | 0 | Not listed | 0 |
| Oakley Tank Lines Inc | Prince George | 49 | 43 | 32 | 18.8% | 2 |
| Road Runner Wrecker Service Inc | Leesburg | 49 | 42 | 18 | 30.8% | 5 |
| Aaron's Towing LLC | Warrenton | 48 | 32 | 22 | 15.4% | 3 |
| Cleco Corporation | Rosedale | 47 | 34 | 30 | 18.8% | 0 |
| G&R Gas Service Inc | Lebanon | 46 | 85 | 0 | Not listed | 0 |
| Aeri Tree Services LLC | Winchester | 44 | 24 | 0 | Not listed | 0 |
| Queeney Enterprises Inc | Suffolk | 43 | 30 | 42 | 41.7% | 1 |
| James River Petroleum Inc | Ashland | 42 | 49 | 76 | 14.8% | 5 |
| Sydnor Hydro Inc | Richmond | 42 | 17 | 0 | Not listed | 0 |
| JL Tree Care Acquisition Company LLC | Fairfax Station | 40 | 65 | 0 | Not listed | 0 |
| Brother's Pro-Pave LLC | Sterling | 40 | 40 | 12 | 42.9% | 0 |
| Huntington Ingalls Incorporated | Newport News | 39 | 86 | 2 | Not listed | 1 |
| Whitehurst Transport Inc | Richmond | 39 | 28 | 39 | 11.5% | 1 |
| Commonwealth Paving Incorporated | Manassas | 38 | 50 | 2 | Not listed | 1 |
| Comcast of Californiamarylandpennsylvaniavirginiawest Virginia LLC | Winchester | 38 | 38 | 6 | Not listed | 1 |
| Woodfin Heating Inc | Richmond | 38 | 29 | 13 | 15.4% | 0 |
| Clark Gas & Oil Company Inc | Stuart | 38 | 28 | 20 | 5.6% | 1 |
| Lci | Manassas | 38 | 1 | 0 | Not listed | 0 |
| American Road Markings LLC | Norfolk | 37 | 42 | 2 | Not listed | 2 |
| A Annandale Inc | Fredericksburg | 37 | 41 | 2 | Not listed | 1 |
| Summit Helicopters Inc | Salem | 37 | 19 | 3 | Not listed | 0 |
| E G Middleton Inc | Norfolk | 36 | 70 | 2 | Not listed | 1 |
| Degesch America Inc | Weyers Cave | 36 | 38 | 2 | Not listed | 0 |
| Shoosmith Construction Inc | Chester | 36 | 16 | 4 | Not listed | 1 |
| Vico Construction Corporation | Chesapeake | 35 | 90 | 20 | 37.5% | 1 |
| Holtzman Propane LC | MT Jackson | 35 | 40 | 10 | 25% | 0 |
Cities
| City | Carriers |
|---|---|
| Richmond | 31 |
| Chesapeake | 22 |
| Norfolk | 20 |
| Manassas | 19 |
| Roanoke | 18 |
| Winchester | 16 |
| Fredericksburg | 15 |
| Sterling | 14 |
| Virginia Beach | 12 |
| Alexandria | 8 |
Updated November 7, 2026. Read from US Department of Transportation, FMCSA Motor Carrier Census, Inspection, Crash and Licensing files. Public domain (U.S. government work). Inspection and crash counts cover November 7, 2024 to November 7, 2026. Fleet size, drivers, cargo and operation are as each carrier reports them to FMCSA and can be out of date. A vehicle or driver out of service order means an inspector ordered the vehicle or driver off the road until the problem was fixed. The national rate comes from every inspection in the same window. Crashes are those state police reported to FMCSA and are not a finding of fault. This page uses US Department of Transportation data and is not endorsed or certified by the Department of Transportation or FMCSA. Free to reuse with credit to SpecStream under CC BY 4.0. Spot a wrong value? Write to [email protected] with the link to this page.