Data / Carriers / Virginia / Winchester, VA
Trucking and bus carriers in Winchester, VA: 74 carriers with 5+ trucks
Winchester, VA has 74 registered motor carriers with 5 or more power units, 22 of them with 20 or more, operating 1,314 power units with 1,218 drivers. From November 7, 2024 to November 7, 2026, their vehicles went out of service in 14.5% of 653 vehicle inspections, against 22.9% for all carriers, and the states reported 56 crashes involving them.
SpecStream is the live web data engine for teams and agents. It reads the carrier register, roadside inspections, crashes and operating authority that FMCSA publishes, and this page is that reading. Ask for the carriers you sell to or insure by state, city, cargo or fleet size, and new inspections, crashes and authority changes arrive in your sheet, CRM, Slack or agent as FMCSA posts them.
- Carriers with 5+ power units
- 74
- With 20+ power units
- 22
- Power units
- 1,314
- Drivers
- 1,218
- Inspections
- 1,007
- Crashes involving these carriers, wherever they happened
- 56
- Vehicle out of service rate
- 14.5% (8.4 points below the national rate, national 22.9%)
Largest carriers in Winchester
Ranked by power units. Counts cover November 7, 2024 to November 7, 2026.
| Carrier | City | Power units | Drivers | Inspections | Vehicle out of service | Crashes |
|---|---|---|---|---|---|---|
| Aero Global Logistics | Winchester | 117 | 129 | 169 | 8.9% | 10 |
| Stuart M Perry Inc | Winchester | 61 | 56 | 9 | 50% | 0 |
| Shenandoah Valley Distributing Company | Winchester | 53 | 49 | 28 | 0% | 1 |
| Virginia Riggers Inc | Winchester | 52 | 92 | 4 | Not listed | 0 |
| Aeri Tree Services LLC | Winchester | 44 | 24 | 0 | Not listed | 0 |
| Extreme Steel Inc | Winchester | 41 | 28 | 4 | Not listed | 0 |
| Comcast of Californiamarylandpennsylvaniavirginiawest Virginia LLC | Winchester | 38 | 38 | 6 | Not listed | 1 |
| Annandale Millwork and Allied Systems Corp | Winchester | 35 | 35 | 69 | 24.1% | 4 |
| Winchester Equipment Co | Winchester | 32 | 33 | 1 | Not listed | 0 |
| C & S Snyder Trucking Inc | Winchester | 32 | 32 | 38 | 6.2% | 7 |
| Shine Transportation Inc | Winchester | 32 | 32 | 102 | 7.5% | 5 |
| Brian Omps Towing & Repair LLC | Winchester | 32 | 11 | 35 | 12.5% | 2 |
| H N Funkhouser & Company | Winchester | 30 | 36 | 20 | 7.7% | 2 |
| Royal Crown Bottling Company of Winchester Inc | Winchester | 29 | 36 | 6 | Not listed | 0 |
| Powell's Plumbing LLC | Winchester | 29 | 17 | 1 | Not listed | 0 |
| Perry Engineering Company Inc | Winchester | 29 | 13 | 1 | Not listed | 0 |
| Malhi Transport Inc | Winchester | 27 | 30 | 91 | 37.5% | 5 |
| Schrock Inc | Winchester | 24 | 24 | 78 | 0% | 1 |
| H H Omps Inc | Winchester | 24 | 18 | 8 | 16.7% | 0 |
| Shockey Bros LLC | Winchester | 21 | 19 | 9 | 60% | 1 |
| Lasting Impressions Quality Concrete | Winchester | 21 | 9 | 0 | Not listed | 1 |
| Schenck Foods Company Incorperated | Winchester | 20 | 17 | 14 | 20% | 0 |
| Im Logistics Group Inc | Winchester | 19 | 23 | 18 | 14.3% | 0 |
| Winchester Medical Center Inc | Winchester | 19 | 11 | 3 | Not listed | 1 |
| W H Emmart & Son Inc | Winchester | 17 | 12 | 4 | Not listed | 0 |
| USA Logistics Inc | Winchester | 16 | 17 | 12 | Not listed | 2 |
| Fitzgerald Excavating & Construction Inc | Winchester | 16 | 13 | 9 | Not listed | 1 |
| B J Sager Inc | Winchester | 15 | 15 | 0 | Not listed | 0 |
| Jade Tree LLC | Winchester | 15 | 15 | 1 | Not listed | 0 |
| Van Metre Base LLC | Winchester | 15 | 14 | 0 | Not listed | 0 |
| Shenandoah Sand Inc | Winchester | 15 | 12 | 8 | Not listed | 0 |
| Minnick's Auto Repair Inc | Winchester | 15 | 11 | 46 | 11.9% | 2 |
| Carroll Construction Company | Winchester | 15 | 8 | 5 | Not listed | 0 |
| Triple T Trucking Inc | Winchester | 13 | 13 | 46 | 7.7% | 2 |
| A Prolawn Service Corp | Winchester | 13 | 3 | 0 | Not listed | 0 |
| Greatscapes Property Management Group LLC | Winchester | 12 | 9 | 0 | Not listed | 0 |
| Omps Garage Inc | Winchester | 12 | 6 | 9 | 11.1% | 0 |
| Johnny Blue Inc | Winchester | 12 | 2 | 1 | Not listed | 0 |
| Rappahannock Petroleum LLC | Winchester | 11 | 11 | 17 | 31.2% | 0 |
| Reading Landscapes Inc | Winchester | 11 | 7 | 3 | Not listed | 1 |
| Wilson's Asphalt Maintenance LLC | Winchester | 11 | 5 | 1 | Not listed | 0 |
| Trex Company Inc | Winchester | 10 | 18 | 4 | Not listed | 0 |
| National Fruit Product Co Inc | Winchester | 10 | 10 | 25 | Not listed | 2 |
| Shenandoah Shuttles Incorporated | Winchester | 10 | 10 | 0 | Not listed | 0 |
| Apple Valley Scale Company Inc | Winchester | 9 | 9 | 2 | Not listed | 0 |
| Barrett Industries Inc | Winchester | 8 | 20 | 0 | Not listed | 0 |
| R & B 9596 Inc | Winchester | 8 | 9 | 9 | Not listed | 3 |
| A Lopez Construction LLC | Winchester | 8 | 8 | 0 | Not listed | 0 |
| Advantage Property Management Inc | Winchester | 8 | 8 | 0 | Not listed | 0 |
| Black Stone Roofing LLC | Winchester | 8 | 6 | 1 | Not listed | 0 |
| Warrior Safety Solutions LLC | Winchester | 8 | 2 | 0 | Not listed | 0 |
| Mover Dudes Inc | Winchester | 7 | 10 | 5 | Not listed | 0 |
| SNT Food and Beverage Inc | Winchester | 7 | 7 | 3 | Not listed | 0 |
| Thompson's Trash Service Inc | Winchester | 7 | 7 | 1 | Not listed | 0 |
| Tire Distributors Inc of VA | Winchester | 7 | 7 | 0 | Not listed | 0 |
| Lorlov LLC | Winchester | 7 | 4 | 0 | Not listed | 0 |
| S&W Excavating LLC | Winchester | 7 | 4 | 7 | Not listed | 0 |
| Valley Regional Enterprises Inc | Winchester | 6 | 12 | 8 | 0% | 0 |
| Z & M Sheet Metal Inc | Winchester | 6 | 7 | 9 | Not listed | 0 |
| S and S Excavating Incorporated | Winchester | 6 | 5 | 0 | Not listed | 0 |
| S&W Excavating LLC | Winchester | 6 | 5 | 0 | Not listed | 0 |
| Carter Crim Enterprise LLC | Winchester | 6 | 3 | 4 | Not listed | 1 |
| Richard Seth Good | Winchester | 5 | 8 | 3 | Not listed | 0 |
| A D Newlin & Son Trucking LLC | Winchester | 5 | 6 | 20 | 26.7% | 1 |
| Ar Carriers Inc | Winchester | 5 | 6 | 6 | Not listed | 0 |
| J & H Trucking | Winchester | 5 | 6 | 0 | Not listed | 0 |
| Kevin Campbell Trucking Inc | Winchester | 5 | 6 | 10 | 0% | 0 |
| Anderson Roofing & Sheet Metal Works Inc | Winchester | 5 | 5 | 0 | Not listed | 0 |
| Bei Delivery Inc | Winchester | 5 | 5 | 3 | Not listed | 0 |
| Elvira Landscaping LLC | Winchester | 5 | 5 | 1 | Not listed | 0 |
| Shumaker Trucking Inc | Winchester | 5 | 5 | 3 | Not listed | 0 |
| Winchester Metals Inc | Winchester | 5 | 5 | 7 | Not listed | 0 |
| Marker-Miller Orchards LLC | Winchester | 5 | 3 | 0 | Not listed | 0 |
| Martin B Gavis | Winchester | 5 | 2 | 0 | Not listed | 0 |
Carriers by fleet size
| Power units | Carriers |
|---|---|
| 5 to 9 | 30 |
| 10 to 19 | 22 |
| 20 to 49 | 18 |
| 50 to 99 | 3 |
| 100 to 499 | 1 |
| 500 or more | 0 |
Cargo carried
Also on SpecStream
Updated November 7, 2026. Read from US Department of Transportation, FMCSA Motor Carrier Census, Inspection, Crash and Licensing files. Public domain (U.S. government work). Inspection and crash counts cover November 7, 2024 to November 7, 2026. Fleet size, drivers, cargo and operation are as each carrier reports them to FMCSA and can be out of date. A vehicle or driver out of service order means an inspector ordered the vehicle or driver off the road until the problem was fixed. The national rate comes from every inspection in the same window. Crashes are those state police reported to FMCSA and are not a finding of fault. This page uses US Department of Transportation data and is not endorsed or certified by the Department of Transportation or FMCSA. Free to reuse with credit to SpecStream under CC BY 4.0. Spot a wrong value? Write to [email protected] with the link to this page.