Data / Carriers / Interstate carriers / Virginia / Page 4
Interstate carriers in Virginia: 2,520, page 4
The full lists. Interstate carriers in Virginia: 2,520 rows, $105.20, or the new rows each week for $19 a month. Interstate carriers in the US: 128,938 rows, $1,369.38, or the new rows each week for $24.10 a month. Pay by card with no account. Prices exclude VAT. CSV and Excel files with the columns this page does not show (phone, email, legal name, DBA name, USDOT number, docket number and 10 more), which open on your screen as soon as the payment clears and come by email. For agents and scripts: every list with its row count and price is at https://specstream.ai/data/lists.json.
Updated November 10, 2026. Source: US Department of Transportation, FMCSA Motor Carrier Census, Inspection, Crash and Licensing files.
Largest of these carriers in Virginia, 301 to 400 of 2,520, in the same order as page 1.
SpecStream is the live web data engine for teams and agents. It reads the carrier register, roadside inspections, crashes and operating authority that FMCSA publishes, and this page is that reading. Ask for the carriers you sell to or insure by state, city, cargo or fleet size, and new inspections, crashes and authority changes arrive in your sheet, CRM, Slack or agent as FMCSA posts them.
Largest of these carriers in Virginia, page 4
| Carrier | City | Power units | Drivers | Inspections | Vehicle out of service | Crashes |
|---|---|---|---|---|---|---|
| Whitehurst Transport Inc | Richmond | 39 | 28 | 39 | 11.5% | 1 |
| Partners Excavating Company | MT Crawford | 39 | 25 | 22 | 30% | 2 |
| VA Crane Rental Inc | Bealeton | 39 | 22 | 1 | Not listed | 0 |
| Virginia Beverage Company LLC | Bristol | 39 | 10 | 0 | Not listed | 0 |
| Tidewater Express Inc | Hampton | 38 | 64 | 6 | Not listed | 5 |
| National Automotive Charging Systems | Powhatan | 38 | 51 | 54 | 3.3% | 1 |
| Commonwealth Paving Incorporated | Manassas | 38 | 50 | 2 | Not listed | 1 |
| DPN Logistics LLC | Portsmouth | 38 | 40 | 4 | Not listed | 0 |
| A Goff Limousine & Bus Company LLC | Ruckersville | 38 | 39 | 3 | Not listed | 1 |
| S2pak LLC | Harrisonburg | 38 | 39 | 66 | 25% | 1 |
| Comcast of Californiamarylandpennsylvaniavirginiawest Virginia LLC | Winchester | 38 | 38 | 6 | Not listed | 1 |
| Freyssinet Inc | Sterling | 38 | 33 | 4 | Not listed | 0 |
| Rail Direct Transportation Company | Portsmouth | 38 | 30 | 56 | 19.6% | 2 |
| Clark Gas & Oil Company Inc | Stuart | 38 | 28 | 20 | 5.6% | 1 |
| Blackwater Electric Co Inc | Chesapeake | 38 | 18 | 0 | Not listed | 0 |
| Whites Construction Company Inc | Sutherlin | 38 | 14 | 7 | Not listed | 1 |
| American Road Markings LLC | Norfolk | 37 | 42 | 2 | Not listed | 2 |
| A Annandale Inc | Fredericksburg | 37 | 41 | 2 | Not listed | 1 |
| Local Services LLC | King George | 37 | 35 | 12 | 75% | 2 |
| Virginia Land Improvement Corporation | Stafford | 37 | 35 | 28 | Not listed | 0 |
| Summit Helicopters Inc | Salem | 37 | 19 | 3 | Not listed | 0 |
| Degesch America Inc | Weyers Cave | 36 | 38 | 2 | Not listed | 0 |
| Burgess Trucking Company Inc | Courtland | 36 | 31 | 15 | Not listed | 0 |
| Fowler Hauling and Home Delivery LLC | King George | 36 | 31 | 41 | 25% | 2 |
| B W Wilson Paper Co Inc | Richmond | 36 | 30 | 78 | 11.8% | 0 |
| Dawson Truck Lines Inc | Roanoke | 36 | 30 | 44 | 47.8% | 0 |
| Brian Calhoun LLC | Alberta | 36 | 26 | 12 | Not listed | 3 |
| CWT Inc | Drakes Branch | 36 | 24 | 34 | 33.3% | 2 |
| Top Gun of Virginia Inc | Lorton | 36 | 24 | 12 | 11.1% | 0 |
| Idea Mount Corp | Ashburn | 36 | 22 | 49 | 11.1% | 0 |
| Tramline Inc | Bluefield | 36 | 12 | 6 | Not listed | 0 |
| New Dominion Construction LLC | Dumfries | 36 | 2 | 0 | Not listed | 0 |
| Black Eagle Limousine Services LLC | Ashburn | 35 | 140 | 0 | Not listed | 0 |
| Vico Construction Corporation | Chesapeake | 35 | 90 | 18 | 42.9% | 1 |
| Total Package Delivery LLC | Sterling | 35 | 67 | 0 | Not listed | 0 |
| Segundo Logistics LLC | South Hill | 35 | 45 | 51 | 31% | 0 |
| Holtzman Propane LC | MT Jackson | 35 | 40 | 10 | 25% | 0 |
| Mda Lexfreight LLC | Bristow | 35 | 40 | 93 | 15% | 3 |
| TBC Associates II LC | Salem | 35 | 40 | 3 | Not listed | 0 |
| 5850 QW Trucking LLC | Prince George | 35 | 35 | 71 | 15.4% | 5 |
| Annandale Millwork and Allied Systems Corp | Winchester | 35 | 35 | 69 | 24.1% | 4 |
| Architectural Graphics Inc | Virginia Beach | 35 | 35 | 0 | Not listed | 0 |
| Accurate Courier Express Inc | N Chesterfield | 35 | 30 | 74 | 19.5% | 4 |
| Holtzman Transport LLC | MT Jackson | 34 | 49 | 40 | 0% | 3 |
| Executive Moving Systems Inc | Woodbridge | 34 | 40 | 18 | 30% | 1 |
| J & J Trucking Enterprise Inc | Chatham | 34 | 34 | 59 | 17.2% | 1 |
| Village Concrete Inc | Manassas | 34 | 34 | 4 | Not listed | 0 |
| Johnson Trucking Company Inc | Boyce | 34 | 32 | 3 | Not listed | 4 |
| Keene Carriers Inc | Lebanon | 34 | 28 | 46 | 10% | 1 |
| M & M Auto Parts | Fredericksburg | 34 | 27 | 19 | 16.7% | 2 |
| Total Image Solutions LLC | South Hill | 34 | 27 | 11 | 16.7% | 0 |
| Torc Robotics Inc | Blacksburg | 34 | 25 | 2 | Not listed | 0 |
| Brocklyn LLC | La Crosse | 34 | 24 | 19 | 0% | 1 |
| JSC Concrete Construction Inc | Manassas Park | 34 | 24 | 9 | 62.5% | 0 |
| Blue Ridge Concrete Products Inc | Cana | 34 | 23 | 13 | 33.3% | 0 |
| J & L Real Estate Development | Rice | 34 | 20 | 12 | Not listed | 1 |
| Willow Spring Towing & Recovery Inc | Chantilly | 34 | 20 | 0 | Not listed | 2 |
| Louise W Eggleston Center Inc | Norfolk | 34 | 13 | 5 | Not listed | 0 |
| Barger Leasing Inc | Weber City | 33 | 50 | 160 | 6.2% | 6 |
| Allsite Contracting LLC | Manassas | 33 | 46 | 4 | Not listed | 1 |
| Point To Point Limousines Inc | Leesburg | 33 | 39 | 0 | Not listed | 0 |
| L L Carter & Son Inc | Ruther Glen | 33 | 31 | 18 | 22.2% | 6 |
| Meade Trucking Company Inc | Verona | 33 | 27 | 10 | Not listed | 1 |
| Payne Logistics LLC | Fredericksburg | 33 | 25 | 25 | 0% | 1 |
| Augusta Cooperative Farm Bureau Inc | Staunton | 33 | 23 | 7 | 20% | 2 |
| Carroll Trucking Inc | Norfolk | 33 | 23 | 85 | 20% | 1 |
| Bedford Cooperative Inc | Bedford | 33 | 21 | 1 | Not listed | 1 |
| R E Lee Electric Co Inc | Newington | 33 | 20 | 0 | Not listed | 0 |
| SMM Southeast LLC | Richmond | 33 | 20 | 45 | 25.9% | 3 |
| Carroll County Cooperative Inc | Hillsville | 33 | 19 | 4 | Not listed | 1 |
| Compo Construction Company | Norfolk | 33 | 8 | 0 | Not listed | 0 |
| Construction Materials Group Inc | Harrisonburg | 32 | 69 | 11 | 25% | 1 |
| W G Construction Co Inc | Manassas Park | 32 | 60 | 0 | Not listed | 0 |
| U-Haul Company of Virginia | Portsmouth | 32 | 59 | 11 | Not listed | 1 |
| Valley Group Inc | Fishersville | 32 | 39 | 32 | 9.1% | 2 |
| JL Tree Service Inc | Fairfax | 32 | 37 | 2 | Not listed | 0 |
| Winchester Equipment Co | Winchester | 32 | 33 | 1 | Not listed | 0 |
| C & S Snyder Trucking Inc | Winchester | 32 | 32 | 38 | 6.2% | 7 |
| H & M Logging Inc | South Boston | 32 | 32 | 25 | 57.1% | 2 |
| Salmons Concrete Hauling Inc | Virginia BCH | 32 | 32 | 5 | Not listed | 0 |
| Shine Transportation Inc | Winchester | 32 | 32 | 102 | 7.5% | 5 |
| Curtis L Mundie Construction Company | Ruckersville | 32 | 29 | 19 | 33.3% | 4 |
| Merchants Grocery Co Inc | Culpeper | 32 | 27 | 14 | 0% | 0 |
| Virginia Trees LLC | Dolphins | 32 | 26 | 14 | 50% | 3 |
| Glass Machinery & Excavation Inc | Jonesville | 32 | 25 | 24 | 11.1% | 2 |
| Murdock Acquisitions LLC | Ashland | 32 | 24 | 23 | 33.3% | 0 |
| Caton Construction Group Inc | Troy | 32 | 19 | 7 | Not listed | 0 |
| The Anderson Company LLC | Manassas | 32 | 16 | 8 | Not listed | 0 |
| Bailess Trucking Inc | Lynchburg | 32 | 15 | 42 | 12.5% | 3 |
| Marva Marble Trucking LLC | Midlothian | 32 | 13 | 91 | 8.9% | 3 |
| SSR Sedan & Limousine Service | Lorton | 32 | 12 | 0 | Not listed | 0 |
| Brian Omps Towing & Repair LLC | Winchester | 32 | 11 | 35 | 12.5% | 2 |
| Andpower LLC | Fairfax Station | 32 | 1 | 4 | Not listed | 0 |
| Joe Moholland Inc | Woodbridge | 31 | 58 | 20 | 28.6% | 1 |
| RCS Moving LLC | Richmond | 31 | 58 | 9 | 0% | 1 |
| Enterprise Logistics LLC | Glen Allen | 31 | 50 | 0 | Not listed | 0 |
| Boot Hill Trucking LLC | Green Bay | 31 | 31 | 37 | 28.6% | 7 |
| Meridian Landscaping LLC | Sterling | 31 | 31 | 13 | 22.2% | 0 |
| General Dynamics Information Technology Inc | Falls Church | 31 | 30 | 20 | 33.3% | 0 |
| George's Foods LLC | Edinburg | 31 | 28 | 22 | 22.2% | 0 |
Public domain (U.S. government work). Inspection and crash counts cover November 10, 2024 to November 10, 2026. Fleet size, drivers, cargo and operation are as each carrier reports them to FMCSA and can be out of date. A vehicle or driver out of service order means an inspector ordered the vehicle or driver off the road until the problem was fixed. The national rate comes from every inspection in the same window. Crashes are those state police reported to FMCSA and are not a finding of fault. This page uses US Department of Transportation data and is not endorsed or certified by the Department of Transportation or FMCSA. Free to reuse with credit to SpecStream under CC BY 4.0. Spot a wrong value? Write to [email protected] with the link to this page.