Data / Carriers / Private fleets / Virginia / Page 3
Private fleets in Virginia: 2,012 with 5+ trucks, page 3
The full lists. Private fleets in Virginia: 2,012 rows, $100.12, or the new rows each week for $19 a month. Private fleets in the US: 152,107 rows, $1,601.07, or the new rows each week for $31.35 a month. Pay by card with no account. Prices exclude VAT. CSV and Excel files with the columns this page does not show (phone, email, legal name, DBA name, USDOT number, docket number and 10 more), which open on your screen as soon as the payment clears and come by email. For agents and scripts: every list with its row count and price is at https://specstream.ai/data/lists.json.
Updated November 10, 2026. Source: US Department of Transportation, FMCSA Motor Carrier Census, Inspection, Crash and Licensing files.
Largest of these carriers in Virginia, 201 to 300 of 2,012, in the same order as page 1.
SpecStream is the live web data engine for teams and agents. It reads the carrier register, roadside inspections, crashes and operating authority that FMCSA publishes, and this page is that reading. Ask for the carriers you sell to or insure by state, city, cargo or fleet size, and new inspections, crashes and authority changes arrive in your sheet, CRM, Slack or agent as FMCSA posts them.
Largest of these carriers in Virginia, page 3
| Carrier | City | Power units | Drivers | Inspections | Vehicle out of service | Crashes |
|---|---|---|---|---|---|---|
| Sydnor Hydro Inc | Richmond | 42 | 17 | 0 | Not listed | 0 |
| Triple S Steel Holdings LLC | Richmond | 41 | 41 | 24 | 36.4% | 0 |
| The Salvation Army & Georgia Corp | Alexandria | 41 | 40 | 2 | Not listed | 0 |
| Trueheart Transportation | Richmond | 41 | 40 | 0 | Not listed | 0 |
| Boxley Readymix LLC | Roanoke | 41 | 30 | 4 | Not listed | 3 |
| Extreme Steel Inc | Winchester | 41 | 28 | 4 | Not listed | 0 |
| Titan Erosion Inc | Manassas Park | 41 | 27 | 3 | Not listed | 1 |
| Giant Delivery LLC | Manassas | 40 | 93 | 9 | 16.7% | 3 |
| JL Tree Care Acquisition Company LLC | Fairfax Station | 40 | 65 | 0 | Not listed | 0 |
| Brother's Pro-Pave LLC | Sterling | 40 | 40 | 12 | 42.9% | 0 |
| Giles County Public Schools | Pearisburg | 40 | 40 | 0 | Not listed | 0 |
| Bruce Howard Contracting Inc | Charles City | 40 | 36 | 13 | 0% | 5 |
| Bowman Consulting Group LTD | Reston | 40 | 30 | 0 | Not listed | 0 |
| Woods Produce Company Inc | Meadows of Dan | 40 | 29 | 41 | 4.5% | 2 |
| Vamac Incorporated | Richmond | 40 | 24 | 17 | 8.3% | 1 |
| JL Culpepper & Co Inc | Ashland | 40 | 20 | 5 | Not listed | 2 |
| Carilion Clinic | Roanoke | 40 | 11 | 3 | Not listed | 0 |
| Isg Rents LLC | Mechanicsville | 40 | 6 | 0 | Not listed | 0 |
| Ty's Hauling & Paving Inc | Richmond | 39 | 90 | 6 | Not listed | 2 |
| Huntington Ingalls Incorporated | Newport News | 39 | 86 | 3 | Not listed | 1 |
| Layman Candy Company Inc | Salem | 39 | 30 | 18 | 28.6% | 3 |
| Partners Excavating Company | MT Crawford | 39 | 25 | 22 | 30% | 2 |
| VA Crane Rental Inc | Bealeton | 39 | 22 | 1 | Not listed | 0 |
| Virginia Beverage Company LLC | Bristol | 39 | 10 | 0 | Not listed | 0 |
| National Automotive Charging Systems | Powhatan | 38 | 51 | 54 | 3.3% | 1 |
| Commonwealth Paving Incorporated | Manassas | 38 | 50 | 2 | Not listed | 1 |
| A Goff Limousine & Bus Company LLC | Ruckersville | 38 | 39 | 3 | Not listed | 1 |
| Comcast of Californiamarylandpennsylvaniavirginiawest Virginia LLC | Winchester | 38 | 38 | 6 | Not listed | 1 |
| Freyssinet Inc | Sterling | 38 | 33 | 4 | Not listed | 0 |
| Woodfin Heating Inc | Richmond | 38 | 29 | 13 | 15.4% | 0 |
| Clark Gas & Oil Company Inc | Stuart | 38 | 28 | 20 | 5.6% | 1 |
| Blackwater Electric Co Inc | Chesapeake | 38 | 18 | 0 | Not listed | 0 |
| Whites Construction Company Inc | Sutherlin | 38 | 14 | 7 | Not listed | 1 |
| Lci | Manassas | 38 | 1 | 0 | Not listed | 0 |
| American Road Markings LLC | Norfolk | 37 | 42 | 2 | Not listed | 2 |
| A Annandale Inc | Fredericksburg | 37 | 41 | 2 | Not listed | 1 |
| Local Services LLC | King George | 37 | 35 | 12 | 75% | 2 |
| T M E Enterprises Inc | Chesapeake | 37 | 35 | 0 | Not listed | 0 |
| Summit Helicopters Inc | Salem | 37 | 19 | 3 | Not listed | 0 |
| E G Middleton Inc | Norfolk | 36 | 70 | 2 | Not listed | 1 |
| Degesch America Inc | Weyers Cave | 36 | 38 | 2 | Not listed | 0 |
| Fowler Hauling and Home Delivery LLC | King George | 36 | 31 | 41 | 25% | 2 |
| B W Wilson Paper Co Inc | Richmond | 36 | 30 | 78 | 11.8% | 0 |
| Brian Calhoun LLC | Alberta | 36 | 26 | 12 | Not listed | 3 |
| CWT Inc | Drakes Branch | 36 | 24 | 34 | 33.3% | 2 |
| Top Gun of Virginia Inc | Lorton | 36 | 24 | 12 | 11.1% | 0 |
| Dulles Transit Partners | Vienna | 36 | 20 | 0 | Not listed | 0 |
| Shoosmith Construction Inc | Chester | 36 | 16 | 4 | Not listed | 1 |
| Tramline Inc | Bluefield | 36 | 12 | 6 | Not listed | 0 |
| C&W Multi-Services LLC | North Chesterfield | 36 | 4 | 0 | Not listed | 0 |
| New Dominion Construction LLC | Dumfries | 36 | 2 | 0 | Not listed | 0 |
| Vico Construction Corporation | Chesapeake | 35 | 90 | 18 | 42.9% | 1 |
| Holtzman Propane LC | MT Jackson | 35 | 40 | 10 | 25% | 0 |
| TBC Associates II LC | Salem | 35 | 40 | 3 | Not listed | 0 |
| 5850 QW Trucking LLC | Prince George | 35 | 35 | 71 | 15.4% | 5 |
| Annandale Millwork and Allied Systems Corp | Winchester | 35 | 35 | 69 | 24.1% | 4 |
| Architectural Graphics Inc | Virginia Beach | 35 | 35 | 0 | Not listed | 0 |
| M Price Distributing Co | Hampton | 35 | 29 | 0 | Not listed | 2 |
| J & J Trucking Enterprise Inc | Chatham | 34 | 34 | 59 | 17.2% | 1 |
| N To N Fiber | Manassas | 34 | 34 | 1 | Not listed | 0 |
| Village Concrete Inc | Manassas | 34 | 34 | 4 | Not listed | 0 |
| M & M Auto Parts | Fredericksburg | 34 | 27 | 19 | 16.7% | 2 |
| Total Image Solutions LLC | South Hill | 34 | 27 | 11 | 16.7% | 0 |
| Torc Robotics Inc | Blacksburg | 34 | 25 | 2 | Not listed | 0 |
| JSC Concrete Construction Inc | Manassas Park | 34 | 24 | 9 | 62.5% | 0 |
| Blue Ridge Concrete Products Inc | Cana | 34 | 23 | 13 | 33.3% | 0 |
| Willow Spring Towing & Recovery Inc | Chantilly | 34 | 20 | 0 | Not listed | 2 |
| Virginia American Water Company | Alexandria | 34 | 13 | 0 | Not listed | 0 |
| Allegheny Construction Company Inc | Roanoke | 34 | 4 | 1 | Not listed | 0 |
| Allsite Contracting LLC | Manassas | 33 | 46 | 4 | Not listed | 1 |
| Specialty Beverage of VA LLC | Sandston | 33 | 28 | 3 | Not listed | 2 |
| Augusta Cooperative Farm Bureau Inc | Staunton | 33 | 23 | 7 | 20% | 2 |
| Bedford Cooperative Inc | Bedford | 33 | 21 | 1 | Not listed | 1 |
| R E Lee Electric Co Inc | Newington | 33 | 20 | 0 | Not listed | 0 |
| SMM Southeast LLC | Richmond | 33 | 20 | 45 | 25.9% | 3 |
| Carroll County Cooperative Inc | Hillsville | 33 | 19 | 4 | Not listed | 1 |
| Compo Construction Company | Norfolk | 33 | 8 | 0 | Not listed | 0 |
| Construction Materials Group Inc | Harrisonburg | 32 | 69 | 11 | 25% | 1 |
| W G Construction Co Inc | Manassas Park | 32 | 60 | 0 | Not listed | 0 |
| U-Haul Company of Virginia | Portsmouth | 32 | 59 | 11 | Not listed | 1 |
| Valley Group Inc | Fishersville | 32 | 39 | 32 | 9.1% | 2 |
| JL Tree Service Inc | Fairfax | 32 | 37 | 2 | Not listed | 0 |
| Winchester Equipment Co | Winchester | 32 | 33 | 1 | Not listed | 0 |
| H & M Logging Inc | South Boston | 32 | 32 | 25 | 57.1% | 2 |
| Salmons Concrete Hauling Inc | Virginia BCH | 32 | 32 | 5 | Not listed | 0 |
| Dominion Paving & Sealing Inc | Midlothian | 32 | 29 | 0 | Not listed | 0 |
| Merchants Grocery Co Inc | Culpeper | 32 | 27 | 14 | 0% | 0 |
| Virginia Trees LLC | Dolphins | 32 | 26 | 14 | 50% | 3 |
| J E Liesfeld Contractor Inc | Rockville | 32 | 25 | 3 | Not listed | 2 |
| Murdock Acquisitions LLC | Ashland | 32 | 24 | 23 | 33.3% | 0 |
| Caton Construction Group Inc | Troy | 32 | 19 | 7 | Not listed | 0 |
| The Anderson Company LLC | Manassas | 32 | 16 | 8 | Not listed | 0 |
| Marva Marble Trucking LLC | Midlothian | 32 | 13 | 91 | 8.9% | 3 |
| Andpower LLC | Fairfax Station | 32 | 1 | 4 | Not listed | 0 |
| Meridian Landscaping LLC | Sterling | 31 | 31 | 13 | 22.2% | 0 |
| Diamond Springs Water Inc | Richmond | 31 | 29 | 0 | Not listed | 0 |
| George's Foods LLC | Edinburg | 31 | 28 | 22 | 22.2% | 0 |
| Dutt & Wagner of Virginia Inc | Abingdon | 31 | 21 | 42 | 22.2% | 1 |
| RJ Smith Construction Inc | Richmond | 31 | 20 | 4 | Not listed | 0 |
| Masters Mechanical, LLC | Newport News | 31 | 16 | 0 | Not listed | 0 |
Public domain (U.S. government work). Inspection and crash counts cover November 10, 2024 to November 10, 2026. Fleet size, drivers, cargo and operation are as each carrier reports them to FMCSA and can be out of date. A vehicle or driver out of service order means an inspector ordered the vehicle or driver off the road until the problem was fixed. The national rate comes from every inspection in the same window. Crashes are those state police reported to FMCSA and are not a finding of fault. This page uses US Department of Transportation data and is not endorsed or certified by the Department of Transportation or FMCSA. Free to reuse with credit to SpecStream under CC BY 4.0. Spot a wrong value? Write to [email protected] with the link to this page.