Data / Carriers / Virginia / Page 4
Trucking companies in Virginia: 25,387 registered, page 4
The full list. Trucking companies in Virginia: 25,387 rows, $333.87, or the new rows each week for $19 a month. Pay by card with no account. Prices exclude VAT. CSV and Excel files with the columns this page does not show (phone, email, legal name, DBA name, USDOT number, docket number and 10 more), which open on your screen as soon as the payment clears and come by email. For agents and scripts: every list with its row count and price is at https://specstream.ai/data/lists.json.
Updated November 10, 2026. Source: US Department of Transportation, FMCSA Motor Carrier Census, Inspection, Crash and Licensing files.
Largest carriers in Virginia, 301 to 400 of 3,341, in the same order as page 1.
SpecStream is the live web data engine for teams and agents. It reads the carrier register, roadside inspections, crashes and operating authority that FMCSA publishes, and this page is that reading. Ask for the carriers you sell to or insure by state, city, cargo or fleet size, and new inspections, crashes and authority changes arrive in your sheet, CRM, Slack or agent as FMCSA posts them.
Largest carriers in Virginia, page 4
| Carrier | City | Power units | Drivers | Inspections | Vehicle out of service | Crashes |
|---|---|---|---|---|---|---|
| Virginia Rides | Culpeper | 43 | 32 | 0 | Not listed | 0 |
| Queeney Enterprises Inc | Suffolk | 43 | 30 | 42 | 41.7% | 1 |
| Benchmark Utility Services LLC | Sterling | 43 | 29 | 4 | Not listed | 0 |
| James River Petroleum Inc | Ashland | 42 | 49 | 76 | 14.8% | 5 |
| Michael and Son Services Inc | Alexandria | 42 | 42 | 7 | 28.6% | 0 |
| Kickin Asphalt Paving & Excavating LLC | Strasburg VA | 42 | 35 | 0 | Not listed | 0 |
| KT Enterprises Inc | Chantilly | 42 | 35 | 0 | Not listed | 0 |
| D W Cary Hauling Inc | Ashland | 42 | 34 | 3 | Not listed | 4 |
| Phoenix Steel Erectors Inc | Gainesville | 42 | 34 | 3 | Not listed | 0 |
| Hills Trucking Company | Galax | 42 | 31 | 42 | 38.9% | 6 |
| A&a Contractors LLC | Chester | 42 | 21 | 4 | Not listed | 4 |
| Sydnor Hydro Inc | Richmond | 42 | 17 | 0 | Not listed | 0 |
| Lasership Inc | Chantilly | 41 | 58 | 3 | Not listed | 0 |
| Venture Tours Inc | Virginia Beach | 41 | 54 | 70 | 0% | 1 |
| Triple S Steel Holdings LLC | Richmond | 41 | 41 | 24 | 36.4% | 0 |
| The Salvation Army & Georgia Corp | Alexandria | 41 | 40 | 2 | Not listed | 0 |
| Trueheart Transportation | Richmond | 41 | 40 | 0 | Not listed | 0 |
| Boxley Readymix LLC | Roanoke | 41 | 30 | 4 | Not listed | 3 |
| Extreme Steel Inc | Winchester | 41 | 28 | 4 | Not listed | 0 |
| Titan Erosion Inc | Manassas Park | 41 | 27 | 3 | Not listed | 1 |
| MVM Inc | Ashburn | 40 | 600 | 0 | Not listed | 0 |
| Giant Delivery LLC | Manassas | 40 | 93 | 9 | 16.7% | 3 |
| Jiji Solutions LLC | Waynesboro | 40 | 90 | 0 | Not listed | 0 |
| Agile Logistics Management LLC | Springfield | 40 | 70 | 0 | Not listed | 0 |
| JL Tree Care Acquisition Company LLC | Fairfax Station | 40 | 65 | 0 | Not listed | 0 |
| Rume Logistics LLC | Staunton | 40 | 60 | 0 | Not listed | 0 |
| Snookumz Logistics LLC | Suffolk | 40 | 45 | 32 | 27.8% | 0 |
| Brother's Pro-Pave LLC | Sterling | 40 | 40 | 12 | 42.9% | 0 |
| Giles County Public Schools | Pearisburg | 40 | 40 | 0 | Not listed | 0 |
| Global Eagle Trucking LLC | Woodbridge | 40 | 40 | 21 | 23.1% | 0 |
| M3 Express LLC | Sterling | 40 | 40 | 14 | 33.3% | 0 |
| Primus Trans LLC | Vienna | 40 | 40 | 106 | 32.7% | 8 |
| Bruce Howard Contracting Inc | Charles City | 40 | 36 | 13 | 0% | 5 |
| Roy Group International LLC | Great Falls | 40 | 34 | 0 | Not listed | 0 |
| Blair's Towing & Recovery Inc | Falls Church | 40 | 30 | 6 | Not listed | 1 |
| Bowman Consulting Group LTD | Reston | 40 | 30 | 0 | Not listed | 0 |
| Woods Produce Company Inc | Meadows of Dan | 40 | 29 | 41 | 4.5% | 2 |
| Vamac Incorporated | Richmond | 40 | 24 | 17 | 8.3% | 1 |
| JL Culpepper & Co Inc | Ashland | 40 | 20 | 5 | Not listed | 2 |
| Carilion Clinic | Roanoke | 40 | 11 | 3 | Not listed | 0 |
| Isg Rents LLC | Mechanicsville | 40 | 6 | 0 | Not listed | 0 |
| Ty's Hauling & Paving Inc | Richmond | 39 | 90 | 6 | Not listed | 2 |
| Huntington Ingalls Incorporated | Newport News | 39 | 86 | 3 | Not listed | 1 |
| G T L Transport Co Inc | Suffolk | 39 | 35 | 57 | 22.2% | 0 |
| Hilltop Mulch Inc | Wirtz | 39 | 31 | 17 | 16.7% | 2 |
| Layman Candy Company Inc | Salem | 39 | 30 | 18 | 28.6% | 3 |
| Whitehurst Transport Inc | Richmond | 39 | 28 | 39 | 11.5% | 1 |
| Partners Excavating Company | MT Crawford | 39 | 25 | 22 | 30% | 2 |
| VA Crane Rental Inc | Bealeton | 39 | 22 | 1 | Not listed | 0 |
| Virginia Beverage Company LLC | Bristol | 39 | 10 | 0 | Not listed | 0 |
| Tidewater Express Inc | Hampton | 38 | 64 | 6 | Not listed | 5 |
| National Automotive Charging Systems | Powhatan | 38 | 51 | 54 | 3.3% | 1 |
| Commonwealth Paving Incorporated | Manassas | 38 | 50 | 2 | Not listed | 1 |
| DPN Logistics LLC | Portsmouth | 38 | 40 | 4 | Not listed | 0 |
| A Goff Limousine & Bus Company LLC | Ruckersville | 38 | 39 | 3 | Not listed | 1 |
| S2pak LLC | Harrisonburg | 38 | 39 | 66 | 25% | 1 |
| Comcast of Californiamarylandpennsylvaniavirginiawest Virginia LLC | Winchester | 38 | 38 | 6 | Not listed | 1 |
| Freyssinet Inc | Sterling | 38 | 33 | 4 | Not listed | 0 |
| Rail Direct Transportation Company | Portsmouth | 38 | 30 | 56 | 19.6% | 2 |
| Woodfin Heating Inc | Richmond | 38 | 29 | 13 | 15.4% | 0 |
| Clark Gas & Oil Company Inc | Stuart | 38 | 28 | 20 | 5.6% | 1 |
| Blackwater Electric Co Inc | Chesapeake | 38 | 18 | 0 | Not listed | 0 |
| Whites Construction Company Inc | Sutherlin | 38 | 14 | 7 | Not listed | 1 |
| Better and Best Home Care LLC | Fredericksbrg | 38 | 3 | 0 | Not listed | 0 |
| Lci | Manassas | 38 | 1 | 0 | Not listed | 0 |
| American Road Markings LLC | Norfolk | 37 | 42 | 2 | Not listed | 2 |
| A Annandale Inc | Fredericksburg | 37 | 41 | 2 | Not listed | 1 |
| Local Services LLC | King George | 37 | 35 | 12 | 75% | 2 |
| T M E Enterprises Inc | Chesapeake | 37 | 35 | 0 | Not listed | 0 |
| Virginia Land Improvement Corporation | Stafford | 37 | 35 | 28 | Not listed | 0 |
| Summit Helicopters Inc | Salem | 37 | 19 | 3 | Not listed | 0 |
| E G Middleton Inc | Norfolk | 36 | 70 | 2 | Not listed | 1 |
| Degesch America Inc | Weyers Cave | 36 | 38 | 2 | Not listed | 0 |
| Burgess Trucking Company Inc | Courtland | 36 | 31 | 15 | Not listed | 0 |
| Fowler Hauling and Home Delivery LLC | King George | 36 | 31 | 41 | 25% | 2 |
| B W Wilson Paper Co Inc | Richmond | 36 | 30 | 78 | 11.8% | 0 |
| Dawson Truck Lines Inc | Roanoke | 36 | 30 | 44 | 47.8% | 0 |
| Brian Calhoun LLC | Alberta | 36 | 26 | 12 | Not listed | 3 |
| CWT Inc | Drakes Branch | 36 | 24 | 34 | 33.3% | 2 |
| Top Gun of Virginia Inc | Lorton | 36 | 24 | 12 | 11.1% | 0 |
| Idea Mount Corp | Ashburn | 36 | 22 | 49 | 11.1% | 0 |
| Dulles Transit Partners | Vienna | 36 | 20 | 0 | Not listed | 0 |
| Shoosmith Construction Inc | Chester | 36 | 16 | 4 | Not listed | 1 |
| Tramline Inc | Bluefield | 36 | 12 | 6 | Not listed | 0 |
| C&W Multi-Services LLC | North Chesterfield | 36 | 4 | 0 | Not listed | 0 |
| New Dominion Construction LLC | Dumfries | 36 | 2 | 0 | Not listed | 0 |
| Black Eagle Limousine Services LLC | Ashburn | 35 | 140 | 0 | Not listed | 0 |
| Vico Construction Corporation | Chesapeake | 35 | 90 | 18 | 42.9% | 1 |
| Total Package Delivery LLC | Sterling | 35 | 67 | 0 | Not listed | 0 |
| Segundo Logistics LLC | South Hill | 35 | 45 | 51 | 31% | 0 |
| Holtzman Propane LC | MT Jackson | 35 | 40 | 10 | 25% | 0 |
| Mda Lexfreight LLC | Bristow | 35 | 40 | 93 | 15% | 3 |
| TBC Associates II LC | Salem | 35 | 40 | 3 | Not listed | 0 |
| 5850 QW Trucking LLC | Prince George | 35 | 35 | 71 | 15.4% | 5 |
| Annandale Millwork and Allied Systems Corp | Winchester | 35 | 35 | 69 | 24.1% | 4 |
| Architectural Graphics Inc | Virginia Beach | 35 | 35 | 0 | Not listed | 0 |
| Accurate Courier Express Inc | N Chesterfield | 35 | 30 | 74 | 19.5% | 4 |
| M Price Distributing Co | Hampton | 35 | 29 | 0 | Not listed | 2 |
| Holtzman Transport LLC | MT Jackson | 34 | 49 | 40 | 0% | 3 |
| Executive Moving Systems Inc | Woodbridge | 34 | 40 | 18 | 30% | 1 |
Public domain (U.S. government work). Inspection and crash counts cover November 10, 2024 to November 10, 2026. Fleet size, drivers, cargo and operation are as each carrier reports them to FMCSA and can be out of date. A vehicle or driver out of service order means an inspector ordered the vehicle or driver off the road until the problem was fixed. The national rate comes from every inspection in the same window. Crashes are those state police reported to FMCSA and are not a finding of fault. This page uses US Department of Transportation data and is not endorsed or certified by the Department of Transportation or FMCSA. Free to reuse with credit to SpecStream under CC BY 4.0. Spot a wrong value? Write to [email protected] with the link to this page.