Data / Carriers / General freight / Virginia / Page 2
General freight carriers in Virginia: 1,699, page 2
The full lists. General freight carriers in Virginia: 1,699 rows, $84.95, or the new rows each week for $19 a month. General freight carriers in the US: 119,951 rows, $1,279.51, or the new rows each week for $19 a month. Pay by card with no account. Prices exclude VAT. CSV and Excel files with the columns this page does not show (phone, email, legal name, DBA name, USDOT number, docket number and 10 more), which open on your screen as soon as the payment clears and come by email. For agents and scripts: every list with its row count and price is at https://specstream.ai/data/lists.json.
Updated November 10, 2026. Source: US Department of Transportation, FMCSA Motor Carrier Census, Inspection, Crash and Licensing files.
Largest of these carriers in Virginia, 101 to 200 of 1,699, in the same order as page 1.
SpecStream is the live web data engine for teams and agents. It reads the carrier register, roadside inspections, crashes and operating authority that FMCSA publishes, and this page is that reading. Ask for the carriers you sell to or insure by state, city, cargo or fleet size, and new inspections, crashes and authority changes arrive in your sheet, CRM, Slack or agent as FMCSA posts them.
Largest of these carriers in Virginia, page 2
| Carrier | City | Power units | Drivers | Inspections | Vehicle out of service | Crashes |
|---|---|---|---|---|---|---|
| Columbia Gas of Virginia Inc | Portsmouth | 58 | 58 | 1 | Not listed | 2 |
| My Guys Moving and Storage Inc | Sterling | 58 | 51 | 39 | 10.5% | 0 |
| Handcraft Cleaners & Launders | Richmond | 57 | 89 | 78 | 9.3% | 10 |
| VSL Electrical Signing Lighting LLC | Manassas | 57 | 72 | 2 | Not listed | 0 |
| C W Strittmatter Inc | Manassas Park | 57 | 56 | 59 | 15.6% | 5 |
| Marine Spill Response Corporation | Herndon | 56 | 162 | 2 | Not listed | 0 |
| Patriot Carriers Inc | Berryville | 56 | 56 | 143 | 41.7% | 9 |
| RCS Trucking & Freight Inc | Bealeton | 55 | 55 | 88 | 18.9% | 8 |
| Larch Tree Service LLC | Norfolk | 54 | 64 | 2 | Not listed | 0 |
| Backline in Motion LLC | Alexandria | 54 | 32 | 0 | Not listed | 0 |
| USA Logistics and Leasing LLC | Chester | 54 | 25 | 0 | Not listed | 0 |
| Mccraw Trucking Inc | Cana | 53 | 49 | 65 | 22.2% | 5 |
| Virginia Riggers Inc | Winchester | 52 | 92 | 4 | Not listed | 0 |
| United Freight Service Inc | Petersburg | 52 | 61 | 80 | 22.6% | 1 |
| 315 Logistics LLC | Virginia Beach | 52 | 50 | 0 | Not listed | 0 |
| I D M Trucking Inc | Weyers Cave | 52 | 42 | 60 | 6.9% | 5 |
| Sonic Transport LLC | Hampton | 52 | 15 | 13 | 25% | 1 |
| GNN Logistics Inc | Portsmouth | 51 | 51 | 79 | 51.5% | 2 |
| Superior Trucking Corporation | Gainesville | 51 | 51 | 26 | Not listed | 2 |
| Akima Logistics Services LLC | Herndon | 51 | 40 | 0 | Not listed | 0 |
| G Grattan LLC | Henrico | 50 | 50 | 14 | 7.7% | 0 |
| Jajk LLC | N Dinwiddie | 50 | 50 | 29 | 25% | 0 |
| Var Logistics LLC | Ashland | 50 | 50 | 6 | Not listed | 1 |
| Dominion Coach Company | Hampton | 50 | 25 | 0 | Not listed | 0 |
| Oakley Tank Lines Inc | Prince George | 49 | 43 | 32 | 18.8% | 2 |
| Road Runner Wrecker Service Inc | Leesburg | 49 | 42 | 18 | 30.8% | 5 |
| Precise Logistics LLC | Richmond | 49 | 28 | 0 | Not listed | 0 |
| Aaron's Towing LLC | Warrenton | 48 | 32 | 22 | 15.4% | 3 |
| Benton Transportation | Alexandria | 48 | 2 | 0 | Not listed | 0 |
| Atlantic Emergency Solutions Inc | Manassas | 47 | 160 | 12 | 16.7% | 0 |
| M C Dean Inc | Ruther Glen | 47 | 119 | 12 | 14.3% | 0 |
| Mobile Delivery LLC | Chesapeake | 47 | 75 | 0 | Not listed | 0 |
| Cleco Corporation | Rosedale | 47 | 34 | 30 | 18.8% | 0 |
| 3 Lil Birds Express LLC | Ashburn | 46 | 147 | 0 | Not listed | 0 |
| G&R Gas Service Inc | Lebanon | 46 | 85 | 0 | Not listed | 0 |
| Novo Transportation LLC | Richmond | 45 | 119 | 76 | 14.9% | 5 |
| Hii Mission Technologies Corp | Virginia Beach | 45 | 66 | 1 | Not listed | 0 |
| Carrington Logistics LLC | Ashland | 45 | 61 | 79 | 26.2% | 8 |
| Sturgeon Transport Inc | Brandy Station | 45 | 40 | 74 | 8.1% | 4 |
| James R Bailey Hauling LLC | Orange | 44 | 44 | 123 | 32.8% | 9 |
| Harrison's Moving & Storage Company Inc | Chesapeake | 44 | 41 | 41 | 22.7% | 0 |
| Aeri Tree Services LLC | Winchester | 44 | 24 | 0 | Not listed | 0 |
| Lopez Trucking II LLC | Lorton | 43 | 43 | 28 | 27.3% | 7 |
| D D & D Trucking LLC | Lynchburg | 43 | 39 | 96 | 26.3% | 8 |
| Queeney Enterprises Inc | Suffolk | 43 | 30 | 42 | 41.7% | 1 |
| Michael and Son Services Inc | Alexandria | 42 | 42 | 7 | 28.6% | 0 |
| KT Enterprises Inc | Chantilly | 42 | 35 | 0 | Not listed | 0 |
| D W Cary Hauling Inc | Ashland | 42 | 34 | 3 | Not listed | 4 |
| Hills Trucking Company | Galax | 42 | 31 | 42 | 38.9% | 6 |
| Lasership Inc | Chantilly | 41 | 58 | 3 | Not listed | 0 |
| Triple S Steel Holdings LLC | Richmond | 41 | 41 | 24 | 36.4% | 0 |
| The Salvation Army & Georgia Corp | Alexandria | 41 | 40 | 2 | Not listed | 0 |
| Boxley Readymix LLC | Roanoke | 41 | 30 | 4 | Not listed | 3 |
| Jiji Solutions LLC | Waynesboro | 40 | 90 | 0 | Not listed | 0 |
| Agile Logistics Management LLC | Springfield | 40 | 70 | 0 | Not listed | 0 |
| Rume Logistics LLC | Staunton | 40 | 60 | 0 | Not listed | 0 |
| Snookumz Logistics LLC | Suffolk | 40 | 45 | 32 | 27.8% | 0 |
| Global Eagle Trucking LLC | Woodbridge | 40 | 40 | 21 | 23.1% | 0 |
| M3 Express LLC | Sterling | 40 | 40 | 14 | 33.3% | 0 |
| Primus Trans LLC | Vienna | 40 | 40 | 106 | 32.7% | 8 |
| Bowman Consulting Group LTD | Reston | 40 | 30 | 0 | Not listed | 0 |
| Woods Produce Company Inc | Meadows of Dan | 40 | 29 | 41 | 4.5% | 2 |
| Carilion Clinic | Roanoke | 40 | 11 | 3 | Not listed | 0 |
| Huntington Ingalls Incorporated | Newport News | 39 | 86 | 3 | Not listed | 1 |
| G T L Transport Co Inc | Suffolk | 39 | 35 | 57 | 22.2% | 0 |
| Hilltop Mulch Inc | Wirtz | 39 | 31 | 17 | 16.7% | 2 |
| Layman Candy Company Inc | Salem | 39 | 30 | 18 | 28.6% | 3 |
| VA Crane Rental Inc | Bealeton | 39 | 22 | 1 | Not listed | 0 |
| Virginia Beverage Company LLC | Bristol | 39 | 10 | 0 | Not listed | 0 |
| Tidewater Express Inc | Hampton | 38 | 64 | 6 | Not listed | 5 |
| National Automotive Charging Systems | Powhatan | 38 | 51 | 54 | 3.3% | 1 |
| DPN Logistics LLC | Portsmouth | 38 | 40 | 4 | Not listed | 0 |
| S2pak LLC | Harrisonburg | 38 | 39 | 66 | 25% | 1 |
| Comcast of Californiamarylandpennsylvaniavirginiawest Virginia LLC | Winchester | 38 | 38 | 6 | Not listed | 1 |
| Freyssinet Inc | Sterling | 38 | 33 | 4 | Not listed | 0 |
| Rail Direct Transportation Company | Portsmouth | 38 | 30 | 56 | 19.6% | 2 |
| Blackwater Electric Co Inc | Chesapeake | 38 | 18 | 0 | Not listed | 0 |
| Whites Construction Company Inc | Sutherlin | 38 | 14 | 7 | Not listed | 1 |
| Better and Best Home Care LLC | Fredericksbrg | 38 | 3 | 0 | Not listed | 0 |
| Lci | Manassas | 38 | 1 | 0 | Not listed | 0 |
| Local Services LLC | King George | 37 | 35 | 12 | 75% | 2 |
| Burgess Trucking Company Inc | Courtland | 36 | 31 | 15 | Not listed | 0 |
| Fowler Hauling and Home Delivery LLC | King George | 36 | 31 | 41 | 25% | 2 |
| Dawson Truck Lines Inc | Roanoke | 36 | 30 | 44 | 47.8% | 0 |
| Brian Calhoun LLC | Alberta | 36 | 26 | 12 | Not listed | 3 |
| CWT Inc | Drakes Branch | 36 | 24 | 34 | 33.3% | 2 |
| Idea Mount Corp | Ashburn | 36 | 22 | 49 | 11.1% | 0 |
| C&W Multi-Services LLC | North Chesterfield | 36 | 4 | 0 | Not listed | 0 |
| Total Package Delivery LLC | Sterling | 35 | 67 | 0 | Not listed | 0 |
| Segundo Logistics LLC | South Hill | 35 | 45 | 51 | 31% | 0 |
| Mda Lexfreight LLC | Bristow | 35 | 40 | 93 | 15% | 3 |
| Architectural Graphics Inc | Virginia Beach | 35 | 35 | 0 | Not listed | 0 |
| Accurate Courier Express Inc | N Chesterfield | 35 | 30 | 74 | 19.5% | 4 |
| Executive Moving Systems Inc | Woodbridge | 34 | 40 | 18 | 30% | 1 |
| J & J Trucking Enterprise Inc | Chatham | 34 | 34 | 59 | 17.2% | 1 |
| JM Staffing and Delivery Service | Leesburg | 34 | 34 | 0 | Not listed | 0 |
| Johnson Trucking Company Inc | Boyce | 34 | 32 | 3 | Not listed | 4 |
| Keene Carriers Inc | Lebanon | 34 | 28 | 46 | 10% | 1 |
| Torc Robotics Inc | Blacksburg | 34 | 25 | 2 | Not listed | 0 |
| JSC Concrete Construction Inc | Manassas Park | 34 | 24 | 9 | 62.5% | 0 |
Public domain (U.S. government work). Inspection and crash counts cover November 10, 2024 to November 10, 2026. Fleet size, drivers, cargo and operation are as each carrier reports them to FMCSA and can be out of date. A vehicle or driver out of service order means an inspector ordered the vehicle or driver off the road until the problem was fixed. The national rate comes from every inspection in the same window. Crashes are those state police reported to FMCSA and are not a finding of fault. This page uses US Department of Transportation data and is not endorsed or certified by the Department of Transportation or FMCSA. Free to reuse with credit to SpecStream under CC BY 4.0. Spot a wrong value? Write to [email protected] with the link to this page.