Data / Carriers / Utilities / Page 27
Utilities carriers in the US: 18,113 with 5+ trucks, page 27
The full list. Utilities carriers in the US: 18,113 rows, $261.13, or the new rows each week for $19 a month. Pay by card with no account. Prices exclude VAT. CSV and Excel files with the columns this page does not show (phone, email, legal name, DBA name, USDOT number, docket number and 9 more), which open on your screen as soon as the payment clears and come by email. For agents and scripts: every list with its row count and price is at https://specstream.ai/data/lists.json.
Updated November 10, 2026. Source: US Department of Transportation, FMCSA Motor Carrier Census, Inspection, Crash and Licensing files.
Largest of these carriers, 2,601 to 2,700 of 18,113, in the same order as page 1.
SpecStream is the live web data engine for teams and agents. It reads the carrier register, roadside inspections, crashes and operating authority that FMCSA publishes, and this page is that reading. Ask for the carriers you sell to or insure by state, city, cargo or fleet size, and new inspections, crashes and authority changes arrive in your sheet, CRM, Slack or agent as FMCSA posts them.
Largest of these carriers, page 27
| Carrier | City | State | Power units | Drivers | Inspections | Vehicle out of service | Crashes |
|---|---|---|---|---|---|---|---|
| Peoples Electric Cooperative | Ada | OK | 39 | 39 | 0 | Not listed | 0 |
| Xro Logistics LLC | Middletown | OH | 39 | 39 | 40 | 27.8% | 2 |
| JLD Enterprises LLC | Auburn | AL | 39 | 38 | 25 | 6.7% | 3 |
| Underwater Engineering Services Inc | Fort Pierce | FL | 39 | 38 | 0 | Not listed | 0 |
| Big Heavy Transport Service LLC | Columbus | MS | 39 | 36 | 34 | 12.5% | 2 |
| Dehumidification Technologies LP | Houston | TX | 39 | 36 | 9 | 33.3% | 1 |
| Power Connect | Apopka | FL | 39 | 36 | 15 | 76.9% | 0 |
| Brookfield White Pine Hydro LLC | Lewiston | ME | 39 | 34 | 0 | Not listed | 0 |
| Ligonier Construction | Laughlintown | PA | 39 | 34 | 0 | Not listed | 0 |
| Stein & Sons LLC | Marionville | MO | 39 | 34 | 102 | 23.9% | 4 |
| Lightspeed Networks Inc | Portland | OR | 39 | 33 | 2 | Not listed | 0 |
| The Empire District Gas Company | Joplin | MO | 39 | 33 | 0 | Not listed | 0 |
| Brock Mountain Land Company LLC | Mars Hill | NC | 39 | 32 | 28 | 7.1% | 0 |
| Speedy Clean Inc | Menasha | WI | 39 | 32 | 3 | Not listed | 0 |
| Mackenzie and Paige Transport LLC | Florence | KY | 39 | 31 | 46 | 23.1% | 2 |
| Clearwater Power Company | Lewiston | ID | 39 | 30 | 3 | Not listed | 0 |
| Mericle Construction Inc | Wilkes-Barre | PA | 39 | 30 | 17 | 16.7% | 1 |
| Jensen's Tree Service Inc | Winston | OR | 39 | 26 | 5 | 0% | 2 |
| Best Enterprises LLC | Depere | WI | 39 | 24 | 13 | 66.7% | 2 |
| Greenbrier Hotel Corporation | White Sulphur Springs | WV | 39 | 24 | 37 | 0% | 0 |
| R E Harrington Plumbing & Heating Inc | Baltimore | MD | 39 | 20 | 8 | 0% | 0 |
| Lighthouse Environmental Services Inc | Houston | TX | 39 | 18 | 27 | 23.1% | 0 |
| Sinacori Landscaping Inc | Shelby TWP | MI | 39 | 18 | 0 | Not listed | 2 |
| Titan Earthwork LLC | Pacific | WA | 39 | 18 | 2 | Not listed | 1 |
| Edgar Electric Inc | Paragould | AR | 39 | 6 | 1 | Not listed | 0 |
| American Water Operations and Maintenance LLC | Camden | NJ | 39 | 3 | 1 | Not listed | 0 |
| C&S Trucking Services Inc | Panorama City | CA | 39 | 2 | 0 | Not listed | 0 |
| Highland Telephone Cooperative Inc | Sunbright | TN | 38 | 73 | 0 | Not listed | 0 |
| South Texas Electric Coop | Nursery | TX | 38 | 72 | 5 | 20% | 1 |
| Omega Rigging & Machinery Moving Inc | Fife | WA | 38 | 66 | 15 | 33.3% | 0 |
| Cadillac Asphalt LLC | Canton | MI | 38 | 65 | 5 | Not listed | 0 |
| Flathead Electric Cooperative Inc | Kalispell | MT | 38 | 64 | 7 | Not listed | 2 |
| The Central Georgia Electric Membership Corporation | Jackson | GA | 38 | 60 | 1 | Not listed | 0 |
| Town of Windsor | Windsor | CO | 38 | 58 | 0 | Not listed | 0 |
| JMF Underground Inc | Mechanicsburg | PA | 38 | 54 | 12 | 25% | 0 |
| Bechtel Jacobs Company LLC | Oak Ridge | TN | 38 | 53 | 0 | Not listed | 0 |
| Connexus Energy | Ramsey | MN | 38 | 50 | 5 | Not listed | 0 |
| Appalachia Transfer Services LLC | Eighty Four | PA | 38 | 49 | 48 | 6.9% | 3 |
| Rsims Construction LLC | Muskego | WI | 38 | 46 | 6 | Not listed | 0 |
| Jolma Utilities LLC | Ashland | WI | 38 | 44 | 15 | 41.7% | 0 |
| Baytrans Inc | Sacramento | CA | 38 | 42 | 140 | 20.4% | 4 |
| RLM Underground LLC | Kansas City | KS | 38 | 42 | 30 | 81.8% | 1 |
| Town & Country Construction LLC | Mayville | WI | 38 | 40 | 0 | Not listed | 0 |
| Aim Expedited Services LLC | Oak Creek | WI | 38 | 38 | 37 | 24.1% | 1 |
| Comcast of Californiamarylandpennsylvaniavirginiawest Virginia LLC | Winchester | VA | 38 | 38 | 6 | Not listed | 1 |
| Eclipse Lighting & Electrical | Anaheim | CA | 38 | 38 | 6 | Not listed | 0 |
| Land Trucking LLC | Dearborn | MI | 38 | 38 | 74 | 30.8% | 5 |
| Prosperity Transportation LLC | Springtown | TX | 38 | 38 | 115 | 21.9% | 4 |
| River City Transport Inc | Dubuque | IA | 38 | 38 | 67 | 17.2% | 1 |
| B & H Freight Line Inc | Clinton | MO | 38 | 37 | 46 | 6.1% | 2 |
| S & D Trucking LLC | Odessa | TX | 38 | 37 | 19 | 42.1% | 1 |
| Freeborn Mower Electric Cooperative | Albert Lea | MN | 38 | 36 | 1 | Not listed | 0 |
| Sheppard Pratt Health System Inc | Towson | MD | 38 | 35 | 0 | Not listed | 0 |
| Dcs-Amez Inc | The Woodlands | TX | 38 | 34 | 52 | 45% | 3 |
| Rokstad Power East Inc | Phoenix | AZ | 38 | 34 | 1 | Not listed | 0 |
| Coggins Construction Company LLC | Thomaston | GA | 38 | 33 | 9 | 40% | 2 |
| Mares Trucking LLC | Amarillo | TX | 38 | 33 | 141 | 18.7% | 9 |
| Nick Holden Transport Company | Dalton | GA | 38 | 33 | 92 | 17.8% | 5 |
| F3 Systems Inc | Santa Rosa | CA | 38 | 31 | 18 | 8.3% | 0 |
| RL Causey Inc | Murrells Inlet | SC | 38 | 31 | 18 | Not listed | 3 |
| Hacienda La Puente Unified School District | La Puente | CA | 38 | 30 | 85 | 2.4% | 0 |
| KW Farms Trucking Inc | Watertown | SD | 38 | 28 | 36 | 0% | 0 |
| Utilicon Services Inc | Davisboro | GA | 38 | 28 | 0 | Not listed | 0 |
| Bailey & Bailey Power Distribution LLC | Hurricane | WV | 38 | 25 | 6 | Not listed | 0 |
| Mackay Construction Services | Wilmington | MA | 38 | 25 | 6 | Not listed | 0 |
| S & H Powerline Construction Inc | Crawford | TX | 38 | 25 | 0 | Not listed | 0 |
| C Brito Construction Co Inc | Bristol | RI | 38 | 23 | 8 | Not listed | 0 |
| Hutchins Telecom Solutions LLC | Shepherdsville | KY | 38 | 23 | 4 | Not listed | 0 |
| Pennichuck Water Works Inc | Merrimack | NH | 38 | 23 | 1 | Not listed | 0 |
| Chancellor Construction LLC | Hattiesburg | MS | 38 | 22 | 0 | Not listed | 0 |
| Jackson Infrastructure Services LLC | Missoula | MT | 38 | 20 | 6 | Not listed | 0 |
| Wheeler Transportation Inc | Roseville | CA | 38 | 20 | 74 | 24.1% | 0 |
| Xquisite Landscaping Inc | Stoughton | MA | 38 | 20 | 2 | Not listed | 0 |
| North American Mining LLC | Medley | FL | 38 | 19 | 4 | Not listed | 1 |
| Blackwater Electric Co Inc | Chesapeake | VA | 38 | 18 | 0 | Not listed | 0 |
| Flatirons Drilling Inc | Greeley | CO | 38 | 18 | 18 | 53.8% | 0 |
| Quanta Energized Services U S LLC | La Grange | TX | 38 | 17 | 2 | Not listed | 0 |
| Francis Trucking Inc | Brigham City | UT | 38 | 15 | 26 | 64.7% | 1 |
| Moore & Moore Services Inc | Homer | AK | 38 | 12 | 2 | Not listed | 0 |
| Power House Line LLC | Centerville | UT | 38 | 10 | 1 | Not listed | 0 |
| JMH Engineering and Construction | Signal Hill | CA | 38 | 8 | 5 | Not listed | 0 |
| Patriot Power and Emergency Services LLC | East Bernstadt | KY | 38 | 5 | 1 | Not listed | 0 |
| Crewse Development LLC | Tacoma | WA | 38 | 4 | 4 | Not listed | 0 |
| Gwakar Express | Middletown | DE | 38 | 4 | 0 | Not listed | 0 |
| NH Communications Inc | Andrews | TX | 38 | 4 | 0 | Not listed | 0 |
| Recovery Logistics LLC | Apex | NC | 38 | 1 | 5 | Not listed | 0 |
| Southwest Louisiana Electric Membership Corp | Lafayette | LA | 37 | 159 | 0 | Not listed | 0 |
| Licking Rural Electrification | Utica | OH | 37 | 78 | 0 | Not listed | 0 |
| Farmers Electric Cooperative Inc | Greenville | TX | 37 | 77 | 2 | Not listed | 1 |
| Yale University | New Haven | CT | 37 | 77 | 2 | Not listed | 5 |
| Associated Telecom Inc | Rock Hill | SC | 37 | 75 | 0 | Not listed | 0 |
| Hewitt Young Electric LLC | Rochester | NY | 37 | 75 | 15 | 0% | 0 |
| Holy Cross Energy | Glenwood Springs | CO | 37 | 71 | 1 | Not listed | 0 |
| Industrial Applied Technologies Inc | Taylor | MI | 37 | 71 | 3 | Not listed | 0 |
| JB'S High Voltage Inc | Woodland | CA | 37 | 68 | 142 | 13% | 1 |
| Northwestern Electric Cooperative Inc | Woodward | OK | 37 | 66 | 1 | Not listed | 0 |
| Structural Services Inc | Nazareth | PA | 37 | 66 | 12 | 33.3% | 0 |
| Cablecom LLC | Glendale | WI | 37 | 54 | 9 | 28.6% | 1 |
| Reinhausen Inc | Humboldt | TN | 37 | 51 | 7 | 0% | 0 |
| Fairway Fleet Services LLC | Wilton | NH | 37 | 50 | 17 | 16.7% | 4 |
Public domain (U.S. government work). Inspection and crash counts cover November 10, 2024 to November 10, 2026. Fleet size, drivers, cargo and operation are as each carrier reports them to FMCSA and can be out of date. A vehicle or driver out of service order means an inspector ordered the vehicle or driver off the road until the problem was fixed. The national rate comes from every inspection in the same window. Crashes are those state police reported to FMCSA and are not a finding of fault. This page uses US Department of Transportation data and is not endorsed or certified by the Department of Transportation or FMCSA. Free to reuse with credit to SpecStream under CC BY 4.0. Spot a wrong value? Write to [email protected] with the link to this page.