Data / Carriers / Utilities / Virginia
Utilities carriers in Virginia: 217 carriers with 5+ trucks
FMCSA lists 217 active carriers in Virginia with 5 or more power units that report utilities cargo, 57 of them with 20 or more, running 7,067 power units with 7,187 drivers. Their vehicles went out of service in 32.1% of 823 vehicle inspections from November 7, 2024 to November 7, 2026, against 22.9% for all carriers.
SpecStream is the live web data engine for teams and agents. It reads the carrier register, roadside inspections, crashes and operating authority that FMCSA publishes, and this page is that reading. Ask for the carriers you sell to or insure by state, city, cargo or fleet size, and new inspections, crashes and authority changes arrive in your sheet, CRM, Slack or agent as FMCSA posts them.
- Carriers with 5+ power units
- 217
- With 20+ power units
- 57
- Power units
- 7,067
- Drivers
- 7,187
- Inspections
- 1,451
- Crashes involving these carriers, wherever they happened
- 113
- Vehicle out of service rate
- 32.1% (9.2 points above the national rate, national 22.9%)
Largest of these carriers in Virginia
Ranked by power units. Counts cover November 7, 2024 to November 7, 2026.
| Carrier | City | Power units | Drivers | Inspections | Vehicle out of service | Crashes |
|---|---|---|---|---|---|---|
| New River Electrical Corporation | Cloverdale | 1,360 | 1,200 | 113 | 27.8% | 7 |
| Virginia Electric & Power Co | Richmond | 894 | 1,653 | 10 | Not listed | 7 |
| CW Wright Construction LLC | South Chesterfield | 436 | 383 | 16 | 27.3% | 2 |
| Adams Construction Company | Roanoke | 308 | 200 | 33 | 5.9% | 14 |
| N&S Construction Inc | Louisa | 278 | 80 | 11 | 40% | 1 |
| Thomas Contracting LLC | Norfolk | 122 | 57 | 10 | 100% | 1 |
| Am Liner East Inc | Vienna | 118 | 60 | 12 | 0% | 0 |
| Tree Care of New York LLC | Norfolk | 96 | 143 | 17 | 37.5% | 1 |
| R B Hinkle Construction Inc | Sterling | 92 | 107 | 34 | 15.4% | 2 |
| Prolift Rigging Company LLC | Rustburg | 92 | 91 | 28 | 30.8% | 4 |
| Shentel Management Company | Edinburg | 85 | 85 | 7 | 0% | 1 |
| Northern Virginia Electric Cooperative | Manassas | 84 | 106 | 0 | Not listed | 1 |
| Mecklenburg Electric Cooperative | Chase City | 76 | 76 | 0 | Not listed | 0 |
| Rappahannock Electric Cooperative | Fredericksburg | 75 | 185 | 2 | Not listed | 2 |
| Two-Tac LLC | Manasssas | 75 | 31 | 8 | Not listed | 2 |
| TTS Tree Service LLC | Norfolk | 71 | 64 | 0 | Not listed | 1 |
| Hardin Tree Inc | Norfolk | 69 | 78 | 0 | Not listed | 1 |
| Taylor's Construction LLC | Chilhowie | 62 | 117 | 22 | 43.8% | 0 |
| Columbia Gas of Virginia Inc | Portsmouth | 58 | 58 | 1 | Not listed | 2 |
| VSL Electrical Signing Lighting LLC | Manassas | 57 | 72 | 2 | Not listed | 0 |
| Southside Electric Cooperative | Crewe | 54 | 85 | 0 | Not listed | 0 |
| Larch Tree Service LLC | Norfolk | 54 | 64 | 2 | Not listed | 0 |
| Sonic Transport LLC | Hampton | 52 | 15 | 13 | 25% | 1 |
| Barc Electric Cooperative | Millboro | 48 | 26 | 0 | Not listed | 0 |
| Cleco Corporation | Rosedale | 47 | 34 | 30 | 18.8% | 0 |
| Aeri Tree Services LLC | Winchester | 44 | 24 | 0 | Not listed | 0 |
| Mcfall Excavating Inc | Clintwood | 44 | 16 | 16 | 20% | 0 |
| Benchmark Utility Services LLC | Sterling | 43 | 29 | 4 | Not listed | 0 |
| Michael and Son Services Inc | Alexandria | 42 | 42 | 7 | 28.6% | 0 |
| The Salvation Army & Georgia Corp | Alexandria | 41 | 40 | 2 | Not listed | 0 |
| Isg Rents LLC | Mechanicsville | 40 | 6 | 0 | Not listed | 0 |
| Comcast of Californiamarylandpennsylvaniavirginiawest Virginia LLC | Winchester | 38 | 38 | 6 | Not listed | 1 |
| Blackwater Electric Co Inc | Chesapeake | 38 | 18 | 0 | Not listed | 0 |
| Virginia American Water Company | Alexandria | 34 | 13 | 0 | Not listed | 0 |
| SMM Southeast LLC | Richmond | 33 | 20 | 46 | 25% | 3 |
| Valley Group Inc | Fishersville | 32 | 39 | 32 | 9.1% | 2 |
| Winchester Equipment Co | Winchester | 32 | 33 | 1 | Not listed | 0 |
| Andpower LLC | Fairfax Station | 32 | 1 | 4 | Not listed | 0 |
| Carry on Trucking Inc | Pulaski | 30 | 30 | 44 | 31.6% | 4 |
| E E Lyons Construction Company Inc | Vienna | 30 | 11 | 11 | 20% | 1 |
| B&B Signal Company LLC | Manassas | 29 | 88 | 3 | Not listed | 0 |
| Bryant Tree Services Inc | Norfolk | 29 | 46 | 0 | Not listed | 0 |
| Cameron Trucking LLC | Ashland | 28 | 21 | 12 | 28.6% | 0 |
| Malhi Transport Inc | Winchester | 27 | 30 | 91 | 37.5% | 5 |
| Main Industries Inc | Hampton | 27 | 8 | 0 | Not listed | 0 |
| Gardner Inc | Cedar Bluff | 26 | 23 | 25 | 15.4% | 1 |
| Gregory Trucking Company Inc | Java | 26 | 23 | 18 | 40% | 0 |
| Ayala Electric LLC | Manassas | 26 | 4 | 0 | Not listed | 0 |
| Palmer Construction Company Inc | Coeburn | 25 | 20 | 0 | Not listed | 0 |
| Leighton Transportation Services Inc | Portsmouth | 25 | 19 | 38 | 23.3% | 1 |
| Seaward Marine Services Inc | Norfolk | 22 | 67 | 3 | Not listed | 0 |
| Conquest USA | Virginia BCH | 22 | 8 | 6 | Not listed | 0 |
| Coastal Fiber LLC | Ashland | 21 | 21 | 2 | Not listed | 0 |
| Sunset Xpress LLC | Harrisonburg | 20 | 20 | 37 | 23.1% | 1 |
| Pross Construction Company Inc | Mineral | 20 | 18 | 2 | Not listed | 0 |
| Orion Associates Inc | Chesapeake | 20 | 16 | 13 | Not listed | 0 |
| JC Driskill Inc | Virginia Beach | 20 | 9 | 0 | Not listed | 0 |
| Romar Elevators Inc | Danville | 18 | 29 | 1 | Not listed | 0 |
| Solutions Fiber Optic Inc | Manassas | 18 | 18 | 24 | 50% | 0 |
| Backbone Construction LLC | Richmond | 18 | 16 | 3 | Not listed | 0 |
| Kustom Carriers Inc | Abingdon | 18 | 15 | 36 | 45.8% | 1 |
| Blueberry Trucking LLC | Hillsville | 17 | 16 | 9 | 0% | 0 |
| Lagan US Inc | Sterling | 17 | 10 | 2 | Not listed | 0 |
| Palencia Construction LLC | Falls Church | 16 | 21 | 0 | Not listed | 0 |
| A & W Contractors Inc | Chesapeake | 16 | 10 | 15 | Not listed | 1 |
| Delta Star Inc | Lynchburg | 15 | 20 | 5 | Not listed | 1 |
| Diamond's Management Group Inc | Manassas | 14 | 14 | 15 | 25% | 0 |
| Lynchburg Crane Service Inc | Bedford | 14 | 14 | 4 | Not listed | 0 |
| J D Watson & Associates Inc | Bristol | 14 | 10 | 10 | Not listed | 1 |
| Jamestown Contracting LLC | Williamsburg | 14 | 2 | 0 | Not listed | 0 |
| Reo Logistics Inc | Waynesboro | 13 | 14 | 0 | Not listed | 0 |
| Chins Transport Inc | Roanoke | 13 | 13 | 33 | 31.2% | 3 |
| Truck Norris Freight LLC | Fairfax | 13 | 13 | 29 | 43.8% | 0 |
| Blue Ridge Area Food Bank | Verona | 13 | 9 | 3 | Not listed | 0 |
| Riggers Inc | Richmond | 13 | 5 | 2 | Not listed | 0 |
| Hubbard Machinery LLC | Dublin | 13 | 3 | 3 | Not listed | 0 |
| Simple Transport LLC | Bridgewater | 13 | 3 | 3 | Not listed | 0 |
| Restoration Services Inc | Virginia Beach | 12 | 48 | 0 | Not listed | 0 |
| Dynalectric Company | Sterling | 12 | 33 | 2 | Not listed | 1 |
| CMR Crane & Rigging LLC | Woodbridge | 12 | 15 | 3 | Not listed | 0 |
| Metro Cable Construction LLC | Centreville | 12 | 12 | 1 | Not listed | 1 |
| N & a Trucking VA LLC | Oilville | 12 | 12 | 19 | 11.1% | 0 |
| Greatscapes Property Management Group LLC | Winchester | 12 | 9 | 0 | Not listed | 0 |
| Rutherford Supply | Richmond | 12 | 9 | 12 | 14.3% | 0 |
| Toney Construction Co Inc | Forest | 11 | 16 | 1 | Not listed | 0 |
| 1850 Crane & Steel LLC | Newport News | 11 | 12 | 1 | Not listed | 0 |
| Infinit Freight LLC | Harrisonburg | 11 | 12 | 30 | 31.2% | 0 |
| Moore's Trucking LLC | Belle Haven | 11 | 11 | 20 | 44.4% | 5 |
| Utilities Unlimited LLC | Manassas | 11 | 11 | 2 | Not listed | 0 |
| WB and E Construction Inc | Chesapeake | 11 | 11 | 0 | Not listed | 0 |
| Croy Contracting Inc | Roanoke | 11 | 8 | 1 | Not listed | 0 |
| CW Cauley & Son Inc | Patrick Springs | 11 | 7 | 0 | Not listed | 1 |
| Raco Inc | Gretna | 11 | 6 | 1 | Not listed | 0 |
| Fixin Electric LLC | Nickelsville | 11 | 5 | 5 | Not listed | 1 |
| Trans Tech Auto Inc | Broadway | 11 | 5 | 1 | Not listed | 0 |
| Niche Logistics | Ashland | 10 | 40 | 1 | Not listed | 0 |
| Team Right of Way LLC | Lyndhurst | 10 | 30 | 0 | Not listed | 0 |
| Virginia Natural Gas | Newport News | 10 | 30 | 1 | Not listed | 0 |
| Anitahaul Inc | Suffolk | 10 | 20 | 0 | Not listed | 0 |
| Valley Contracting LLC | Churchville | 10 | 17 | 6 | Not listed | 1 |
Cities
| City | Carriers |
|---|---|
| Manassas | 11 |
| Norfolk | 10 |
| Chesapeake | 9 |
| Richmond | 8 |
| Winchester | 8 |
| Sterling | 7 |
| Roanoke | 6 |
| Virginia Beach | 5 |
| Fredericksburg | 3 |
| Alexandria | 3 |
Updated November 7, 2026. Read from US Department of Transportation, FMCSA Motor Carrier Census, Inspection, Crash and Licensing files. Public domain (U.S. government work). Inspection and crash counts cover November 7, 2024 to November 7, 2026. Fleet size, drivers, cargo and operation are as each carrier reports them to FMCSA and can be out of date. A vehicle or driver out of service order means an inspector ordered the vehicle or driver off the road until the problem was fixed. The national rate comes from every inspection in the same window. Crashes are those state police reported to FMCSA and are not a finding of fault. This page uses US Department of Transportation data and is not endorsed or certified by the Department of Transportation or FMCSA. Free to reuse with credit to SpecStream under CC BY 4.0. Spot a wrong value? Write to [email protected] with the link to this page.