Skip to the page
Get started – free

Data / Podcasts / Nutrition / English

Nutrition podcasts in English: 1,514 active shows (2026)

1,514 nutrition podcasts in English published an episode in the last 90 days to October 31, 2026. 587 publish at least weekly and 580 published in the last 7 days. The list gives each show's owner, episode count, last episode, publishing frequency, website and feed, read from the Podcast Index on November 3, 2026.

SpecStream is the live web data engine for teams and agents. It reads the Podcast Index every day, and this page is that reading. Ask for the shows you want by topic, language and how often they publish, with each show's contact, and new and changed shows arrive in your sheet, CRM, Slack or agent.

Get nutrition podcasts in EnglishWatch for new shows

How often these shows publish

1,514 active shows. 580 published in the last 7 days and 1,215 in the last 30.

PublishesShows
Daily19
Several times a week58
Weekly510
Every two weeks482
Monthly340
Less than monthly61
All episodes at once11
One episode33

Active nutrition podcasts in English, 1 to 500

ShowOwnerEpisodesLast episodePublishesWebsiteFeedSource
Fitness ConfidentialVinnie Tortorich1,000October 30, 2026Several times a weekvinnietortorich.comhttps://angriesttrainer.libsyn.com/rsspodcastindex.org
Fruci Fit PodcastMatt Fruci1,000October 30, 2026Dailyfrucifit.comhttps://rss.buzzsprout.com/398758.rsspodcastindex.org
CONSISTENT by Primal PotentialElizabeth Benton1,000October 27, 2026Several times a weekprimalpotential.comhttps://feeds.captivate.fm/consistent-by-primal/podcastindex.org
Juicebox Podcast: Type 1 DiabetesScott Benner1,000October 31, 2026Dailyjuiceboxpodcast.comhttps://juiceboxpodcast.libsyn.com/rsspodcastindex.org
The Chalene Show | Pop Culture, Women's Health, & FitnessChalene Johnson1,000October 31, 2026Several times a weekchalene.com/podcasthttps://turbochargedlife.libsyn.com/rsspodcastindex.org
The Wellness Mama PodcastKatie Wells1,000October 28, 2026Several times a weekbuzzsprout.com/196948https://rss.buzzsprout.com/196948.rsspodcastindex.org
Eric Roberts FitnessEric Roberts1,000October 30, 2026Several times a weekericrobertsfitness.comhttps://ericrobertsfitness.com/feed/podcast/podcastindex.org
Simply Slim with Stu Schaefer: Weight Loss Made SimpleStu Schaefer1,000October 30, 2026Dailystuschaefer.comhttps://stuschaefer.libsyn.com/rsspodcastindex.org
Well Beyond 40JJ Virgin1,000October 30, 2026Several times a weekjjvirgin.comhttps://rss2.flightcast.com/p71u2imr2431o3aij1bl9mwm.xmlpodcastindex.org
Barbell ShruggedDoug Larson1,000October 28, 2026Several times a weekbarbellshrugged.comhttps://barbellshrugged.libsyn.com/rsspodcastindex.org
The Doctor Is In PodcastAnthony Martin1,000October 30, 2026Dailymartinclinic.libsyn.com/podcasthttps://martinclinic.libsyn.com/rsspodcastindex.org
Boundless Body RadioCasey Ruff1,000October 30, 2026Several times a weekmyboundlessbody.comhttps://rss.buzzsprout.com/1244183.rsspodcastindex.org
Thrasherway PodcastHENRY THRASHER1,000October 31, 2026Dailythethrasherway.libsyn.com/websitehttps://thethrasherway.libsyn.com/rsspodcastindex.org
thethrasherway's podcastHenry Thrasher1,000October 31, 2026Dailyspreaker.com/show/thethrasherways-podcasthttps://www.spreaker.com/show/4350133/episodes/feedpodcastindex.org
Plant Based BriefingMarian Erikson1,000October 28, 2026Several times a weekplantbasedbriefing.comhttps://plantbasedbriefing.libsyn.com/rsspodcastindex.org
Dr. Shawn Baker PodcastDr. Shawn Baker1,000October 30, 2026Several times a weekcarnivore.diethttps://rss.libsyn.com/shows/241823/destinations/1808258.xmlpodcastindex.org
Podcast Archives - Eric RobertsEric Roberts1,000October 28, 2026Several times a weekericrobertsfitness.com/category/podcasthttps://ericrobertsfitness.com/category/podcast/feed/podcastindex.org
Thrasherway PodcastHLT1,000October 31, 2026Dailythethrasherway.libsyn.com/websitehttps://rss.buzzsprout.com/2403093.rsspodcastindex.org
DocStar PodcastBraveHeartNation Station1,000October 8, 2026Dailyspreaker.com/podcast/docstar-podcast--5820171https://www.spreaker.com/show/5820171/episodes/feedpodcastindex.org
Dishing Up NutritionNutritional Weight & Wellness, Inc.999October 29, 2026Weeklyweightandwellness.com/resources/podcastshttps://dishingupnutrition.podbean.com/feed.xmlpodcastindex.org
Dishing Up NutritionNutritional Weight & Wellness, Inc.999October 29, 2026Weeklyweightandwellness.com/resources/podcastshttps://feed.podbean.com/dishingupnutrition/feed.xmlpodcastindex.org
Keeping It Real: Conversations with Jillian MichaelsJillian Michaels986October 30, 2026Weeklyjillianmichaels.comhttps://feeds.speakeasystudio.ai/feeds/YUYoUqHhqy4vqXTG/feed.xml?1785784371podcastindex.org
Good Day HealthDoug Stephan976October 29, 2026Weeklyspreaker.com/show/good-day-health_1http://podcast.radioamerica.org/gooddayhealth.rsspodcastindex.org
THE EMBC NETWORK Featuring: ihealthradio and Worldwide PodcastsHurricane H965October 31, 2026Several times a weektheembctvnetwork.comhttps://feed.pod.co/ihealthradiopodcastindex.org
Sam Miller ScienceSam Miller942October 27, 2026Several times a weeksammillerscience.comhttps://anchor.fm/s/101ac90e8/podcast/rsspodcastindex.org
Don't Wait For Your Wake Up Call!Melissa Deally940October 31, 2026Several times a weekyourguidedhealthjourney.com/podcasthttps://feeds.captivate.fm/dont-wait-for-your-wake-up-call/podcastindex.org
The Tony Wrighton PodcastTony Wrighton908October 26, 2026Weeklytonywrighton.com/podcasthttps://zestology.libsyn.com/rsspodcastindex.org
Ditch Decade Diets PodcastLorna Costa - Binge Eating Coach890October 28, 2026Several times a weekbuzzsprout.com/1719090https://rss.buzzsprout.com/1719090.rsspodcastindex.org
Nutrition DivaMacmillan Holdings, LLC870October 28, 2026Weeklyquickanddirtytips.compodcastindex.org
The Armor Men's Health ShowDr. Sandeep Mistry and Donna Lee859October 28, 2026Several times a weekarmormenshealth.comhttps://rss.buzzsprout.com/641953.rsspodcastindex.org
Mill Creek OA 100 Pounder Speaker MeetingPaul Gadebusch835October 26, 2026Every two weeksmillcreekmeeting.libsyn.comhttps://millcreekmeeting.libsyn.com/rsspodcastindex.org
The Female Health Solution PodcastThe Female Health Solution Podcast808October 26, 2026Weeklydrbethwestie.comhttps://drbethwestie.libsyn.com/rsspodcastindex.org
The Exam Room by the Physicians CommitteePhysicians Committee804October 26, 2026Weeklypcrm.org/podcasthttps://examroom.libsyn.com/rsspodcastindex.org
The Exam Room by the Physicians Committeecvfr804October 26, 2026Weeklyspreaker.com/podcast/the-exam-room-by-the-physicians-committee--7453861https://www.spreaker.com/show/7453861/episodes/feedpodcastindex.org
The Mind Muscle ConnectionJeff Hoehn798October 30, 2026Several times a weekbuzzsprout.com/1508401https://rss.buzzsprout.com/1508401.rsspodcastindex.org
Dr. Jockers Functional NutritionDr. Jockers791October 30, 2026Several times a weekdrjockers.comhttps://jockers.libsyn.com/rsspodcastindex.org
Fit Womens Weekly PodcastKindal Boyle785October 27, 2026Weeklyfitwomensweekly.comhttps://whatthefitness.libsyn.com/rsspodcastindex.org
The Brad Jensen ShowBrad Jensen773September 25, 2026Weeklybecomenextlevel.comhttps://keynutrition.libsyn.com/rsspodcastindex.org
The Melissa Ambrosini ShowMelissa Ambrosini Pty Ltd771October 19, 2026Weeklymelissaambrosini.com/podcasthttps://feeds.acast.com/public/shows/06b81cea-50f9-4510-80bc-38d1ea2a27f0podcastindex.org
The Fitness Business Podcast with Erin Dimond and Jordan DuggerErin Dimond and Jordan Dugger765August 13, 2026Weeklyflowstateofmindpodcast.libsyn.com/websitehttps://flowstateofmindpodcast.libsyn.com/rsspodcastindex.org
Salad With a Side of Fries Nutrition, Wellness & Weight LossJenn Trepeck730October 30, 2026Weeklyasaladwithasideoffries.comhttps://feeds.captivate.fm/saladwithasideoffries/podcastindex.org
The Jesse Chappus ShowJesse Chappus728October 27, 2026Weeklyjessechappus.comhttps://feeds.captivate.fm/jessechappus/podcastindex.org
Get Leaner & Live LongerNate Palmer725October 20, 2026Weeklymilliondollarbodylabs.comhttps://millionpoundmission.libsyn.com/rsspodcastindex.org
Get Leaner & Live LongerNate Palmer725October 20, 2026Weeklymilliondollarbodylabs.comhttps://feeds.libsyn.com/111554/rsspodcastindex.org
Get Leaner & Live LongerNate Palmer725October 20, 2026Weeklymilliondollarbodylabs.comhttps://rss.libsyn.com/shows/111554/destinations/619652.xmlpodcastindex.org
Embrace Your RealJulie Ledbetter692October 29, 2026Weeklyjuliealedbetter.comhttps://embraceyourreal.libsyn.com/rsspodcastindex.org
Wits & Weights | Strength & Fat Loss Over 40Philip Pape | Strength Training & Fat Loss Over 40690October 31, 2026Several times a weekwitsandweights.comhttps://rss.buzzsprout.com/1870546.rsspodcastindex.org
Vitality Radio Podcast with Jared St. ClairJared St. Clair689October 31, 2026Weeklyvitalityradio.comhttps://feeds.transistor.fm/vitality-radio-podcast-with-jared-st-clairpodcastindex.org
Living LeanJeremiah Bair686October 23, 2026Weeklybairfit.comhttps://api.riverside.com/hosting/GIG6owbI.rsspodcastindex.org
Living LeanJeremiah Bair686October 23, 2026Weeklybairfit.comhttps://rss.buzzsprout.com/712032.rsspodcastindex.org
The Thyroid (and Hormone) Fixer Podcast: Thyropause, Menopause, Metabolism and How to Fix ItDr. Amie Hornaman677October 27, 2026Several times a weekdramie.comhttps://rss2.flightcast.com/ee1bp3zh9h0d003fe1kvtfgi.xmlpodcastindex.org
Healthy Catholic MomsBrittany Pearson666October 30, 2026Weekly955537.buzzsprout.comhttps://rss.buzzsprout.com/955537.rsspodcastindex.org
Myers Detox PodcastDr. Wendy Myers658October 29, 2026Weeklymyersdetox.comhttps://wendymyers.libsyn.com/rsspodcastindex.org
The No Sugarcoating PodcastAmber Romaniuk655October 28, 2026Weeklyamberapproved.cahttps://amberapproved.libsyn.com/rsspodcastindex.org
Mind Your HormonesCorinne Angelica652October 29, 2026Several times a weekmindyourhormones.buzzsprout.comhttps://rss.buzzsprout.com/1822805.rsspodcastindex.org
Sigma Nutrition RadioDanny Lennon648October 27, 2026Weeklysigmanutrition.comhttps://sigmanutrition.libsyn.com/rss/podcastindex.org
The Jay Ferruggia ShowJay Ferruggia635October 23, 2026Weeklyjasonferruggia.comhttps://jasonferruggia.libsyn.com/rsspodcastindex.org
The Simplicity SessionsJenn Pike623October 29, 2026Weeklyjennpike.comhttps://thesimplicitysessions.libsyn.com/rsspodcastindex.org
Confessions of a Binge EaterTricia Nelson622October 29, 2026Weeklyhealyourhunger.comhttps://feeds.libsyn.com/88541/rsspodcastindex.org
Confessions of a Binge EaterConfessions of a Binge Eater600October 29, 2026Weeklyhealyourhunger.compodcastindex.org
The Real Truth About Health Free 17 Day Live Online Conference PodcastThe Real Truth About Health600October 31, 2026Dailyfirst-real-truth-test-podcast.simplecast.comhttps://feeds.simplecast.com/23FjEcS2podcastindex.org
TheBrief.HealthTheBrief.Health600October 29, 2026Dailythebrief-health.simplecast.comhttps://feeds.simplecast.com/3xFUWysrpodcastindex.org
The Shane Walsh PodcastShane Walsh588October 29, 2026Weeklyshanewalshfitness.libsyn.comhttps://shanewalshfitness.libsyn.com/rsspodcastindex.org
Organic Healthy LifestyleTalk 4 Radio586October 20, 2026Weeklyspreaker.com/show/organic-healthy-lifestylehttps://www.spreaker.com/show/1237308/episodes/feedpodcastindex.org
Get Pregnant NaturallySarah Clark578October 26, 2026Weeklyfabfertile.com/podcasthttps://getpregnant.libsyn.com/rsspodcastindex.org
Beast over Burden powered by Barbell LogicBarbell Logic576October 27, 2026Weeklybarbell-logic.com/barbell-logic-podcast-episodeshttps://barbelllogic.libsyn.com/rsspodcastindex.org
Beast over Burden powered by Barbell LogicBarbell Logic576October 27, 2026Weeklybarbell-logic.com/barbell-logic-podcast-episodeshttps://rss.libsyn.com/shows/103025/destinations/548333.xmlpodcastindex.org
The Poehlmann Fitness ShowAdam Poehlmann557October 23, 2026Weeklyadampoehlmann.substack.com/podcastpodcastindex.org
The Hormone Solution | Menopause, Perimenopause, & Women's Midlife HealthKaren Martel555October 31, 2026Weeklykarenmartel.comhttps://karenmartel.libsyn.com/rsspodcastindex.org
The Hormone Solution | Menopause, Perimenopause, & Women's Midlife HealthKaren Martel555October 31, 2026Weeklykarenmartel.comhttps://feeds.libsyn.com/133151/rsspodcastindex.org
The Hormone Solution | Menopause, Perimenopause, & Women's Midlife HealthKaren Martel555October 31, 2026Weeklykarenmartel.comhttps://rss.pdrl.fm/0d7402/feeds.libsyn.com/133151/rss/?redirect=falsepodcastindex.org
There Is A Method to the MadnessRob Maxwell, M.A.545October 27, 2026Several times a weekfittothemax.nethttps://rss.buzzsprout.com/1931406.rsspodcastindex.org
Intermittent Fasting StoriesGin Stephens543October 29, 2026Weeklyart19.com/shows/intermittent-fasting-storieshttps://rss.art19.com/intermittent-fasting-storiespodcastindex.org
Optimal Protein Podcast with Vanessa SpinaVanessa Spina540October 30, 2026Several times a weekketogenicgirl.comhttps://fastketo.libsyn.com/rsspodcastindex.org
Dietitian Boss with Libby RothschildLibby Rothschild536October 26, 2026Weeklydietitianboss.com/podcasts/dietitian-boss-with-libby-rothschildhttps://app.kajabi.com/podcasts/2147511177/feedpodcastindex.org
Investing in Regenerative Agriculture and FoodKoen van Seijen528October 27, 2026Weeklyinvestinginregenerativeagriculture.comhttps://rss.buzzsprout.com/1154870.rsspodcastindex.org
Baby-Led Weaning with Katie FerraroKatie Ferraro517October 29, 2026Weeklyblwpodcast.comhttps://feeds.megaphone.fm/ARML2599927519podcastindex.org
Baby-Led Weaning with Katie FerraroKatie Ferraro517October 29, 2026Weeklyblwpodcast.comhttps://rss.pdrl.fm/273915/feeds.megaphone.fm/ARML2599927519podcastindex.org
Real Health Radio512October 22, 2026Every two weeksseven-health.comhttps://www.seven-health.com/feed/podcast/podcastindex.org
Nourished FertilityVictoria Myers RD/N511October 13, 2026Weeklynourishedfertility.cohttps://nourishingwomenpodcast.libsyn.com/rsspodcastindex.org
Nourished FertilityVictoria Myers RD/N511October 13, 2026Weeklynourishedfertility.cohttps://rss.libsyn.com/shows/104026/destinations/555893.xmlpodcastindex.org
Biblical Nutrition Academy PodcastAnnette Reeder510October 21, 2026Weeklybiblicalnutritionacademy.libsyn.com/websitehttps://biblicalnutritionacademy.libsyn.com/rsspodcastindex.org
NYPTALKSHOW PodcastRon Brown509October 23, 2026Several times a weeknyptalkshow.comhttps://rss.buzzsprout.com/2227857.rsspodcastindex.org
Cannabis Health Radio PodcastCannabis Health Radio503October 18, 2026Weeklycannabishealthradio.com/podcasthttps://feeds.simplecast.com/LRe2WJ_1podcastindex.org
Dieting from the Inside OutJared Hamilton502October 29, 2026Weeklybit.ly/DFIOcollectivehttps://anchor.fm/s/2357a80/podcast/rsspodcastindex.org
From a Woman's Perspective with Marilyn WetstonMarilyn Wetston500October 24, 2026Weeklyzoomerradio.ca/podcasts/from-a-womans-perspective-podcasthttps://rss.amperwave.net/v2/feed/mz-media/from_a_womans_perspective_itunespodcastindex.org
Food Matters Live PodcastFood Matters Live500October 26, 2026Weeklyfoodmatterslive.comhttps://audioboom.com/channels/4990360.rsspodcastindex.org
Good Things with Rebecca TurnerSuperTalk Mississippi500October 29, 2026Dailyhttps://rss.amperwave.net/v2/feed/telesouth/good_things_with_rebecca_turner___apple_podcastspodcastindex.org
BETTER! with Dr. Stephanie Estima | Strength, Body Composition & PerimenopauseDr. Stephanie Estima498October 26, 2026Weeklydrstephanieestima.com/podcasthttps://feeds.simplecast.com/PpiFYEvkpodcastindex.org
Running: A FEVERPadua Podcast Network485October 29, 2026Weeklyrunningafever.comhttps://runningafever.libsyn.com/rsspodcastindex.org
LONGEVITY with Nathalie NiddamNathalie Niddam482October 29, 2026Weeklynathalieniddam.comhttps://rss2.flightcast.com/zuvawsnkkxtbynwgy0632z94.xmlpodcastindex.org
Less Stressed Life: Helping You Heal YourselfChrista Biegler478October 26, 2026Weeklychristabiegler.comhttps://rss.buzzsprout.com/775589.rsspodcastindex.org
Rational Wellness PodcastBen Weitz, DC478October 28, 2026Weeklydrweitz.comhttps://feeds.libsyn.com/91762/rsspodcastindex.org
The Mike Dolce ShowMike Dolce - Creator of The Dolce Diet473October 13, 2026Every two weeksthedolcediet.comhttps://themikedolceshow.libsyn.com/rsspodcastindex.org
Strong By Design PodcastTeam CriticalBench472October 28, 2026Weeklycriticalbench.comhttps://rss.buzzsprout.com/2311482.rsspodcastindex.org
Smart Digestion RadioDr. Christine Kaczmar463August 19, 2026Every two weeksthedigestiondoctor.comhttps://quickbites.libsyn.com/rsspodcastindex.org
Save My Thyroid: Healing Tips for Hyperthyroidism and Hashimoto'sDr. Eric Osansky DC, IFMCP462October 27, 2026Weeklysavemythyroid.comhttps://rss.buzzsprout.com/1837294.rsspodcastindex.org
Fuel Your StrengthSteph Gaudreau461October 27, 2026Every two weeksstephgaudreau.comhttps://hardertokillradio.libsyn.com/rsspodcastindex.org
The LongHer LifeBrittany Ford458October 23, 2026Weeklybiohackingbrittany.comhttps://biohackingwithbrittany.libsyn.com/rsspodcastindex.org
Balance365 Life RadioBalance365 Life455October 28, 2026Weeklybalance365life.comhttps://rss.libsyn.com/shows/160058/destinations/1051409.xmlpodcastindex.org
Vital Health Radio DownloadVital Health Radio Download451October 27, 2026Weeklyvitalhealthradio.com/bloghttps://vitalhealthradio.com/feed/podcast/podcastindex.org
Ultimate Health MediaDr. Brad Schapiro449August 31, 2026Weeklyultimatehealthtn.comhttps://rss.buzzsprout.com/719526.rsspodcastindex.org
Purple Patch PodcastMatt Dixon448October 28, 2026Weeklypurplepatchfitness.comhttps://purplepatch.libsyn.com/rsspodcastindex.org
Beyond The Truck Podcast with Jerry CurlJerry Curl448October 30, 2026Dailytcsaleadership.comhttps://rss.buzzsprout.com/2456186.rsspodcastindex.org
Confidence Through HealthJerry Snider446October 29, 2026Weeklyconfidence-through-health.simplecast.comhttps://feeds.simplecast.com/P9zEf_FZpodcastindex.org
The Well-Built LifeThe Well-Built Life441October 31, 2026Dailyspreaker.com/podcast/the-well-built-life--7152814https://www.spreaker.com/show/7152814/episodes/feedpodcastindex.org
Hot, Healthy, Never HungryLauren Hubert MS, RD439October 29, 2026Weeklythesororitynutritionist.libsyn.com/websitehttps://thesororitynutritionist.libsyn.com/rsspodcastindex.org
The Proof with Simon HillSimon Hill438October 29, 2026Weeklytheproof.com/podcasthttps://feeds.megaphone.fm/IHINL7082362864podcastindex.org
Harmony With FoodMeg Marie ORourke438October 28, 2026Weeklyharmonywithfood.comhttps://www.spreaker.com/show/2799617/episodes/feedpodcastindex.org
The Proof with Simon HillSimon Hill438October 29, 2026Weeklytheproof.com/podcasthttps://feeds.megaphone.fm/theproofpodcastindex.org
The Doctor's Kitchen PodcastDr Rupy Aujla435October 21, 2026Weeklythedoctorskitchen.comhttps://feeds.acast.com/public/shows/64913e28-7031-4ea6-9bef-fddf46dfed87podcastindex.org
Boss Bitch Radio w/IFBB Pro, Diane FloresDiane Flores434October 30, 2026Weeklybossbitchradio.comhttps://bossbitchradio.libsyn.com/rsspodcastindex.org
The Healthy Skin ShowJennifer Fugo, MS, CNS, Clinical Nutritionist431October 29, 2026Weeklythehealthyskinshow.libsyn.com/websitehttps://rss.buzzsprout.com/2332278.rsspodcastindex.org
The Funk'tional Nutrition PodcastErin Holt430October 27, 2026Weeklythefunktionalnutritionist.com/the-funktional-nutrition-podcasthttps://feeds.captivate.fm/the-funktional-nutritionist/podcastindex.org
The Vet Blast Podcast presented by dvm360The Vet Blast Podcast428October 27, 2026Weeklydvm360.com/podcastshttps://audioboom.com/channels/5028100.rsspodcastindex.org
It’s Beyond The Food: Non-Diet Health CoachingStephanie Dodier426October 29, 2026Weeklystephaniedodier.comhttps://podcasts.helloaudio.fm/podcast/667659f6-a2de-4759-a187-247df102f4e7/fBNRcNnsrupodcastindex.org
Real Life Weight LossCorey Little424October 27, 2026Weeklyreal-life-weight-loss.captivate.fmhttps://feeds.captivate.fm/real-life-weight-loss/podcastindex.org
Biceps After Babies RadioAmber Brueseke422October 20, 2026Weeklybicepsafterbabies.com/podcasthttps://rss.buzzsprout.com/2102443.rsspodcastindex.org
The Show Up Fitness PodcastChris Hitchko, CEO Show Up Fitness422October 31, 2026Several times a weekshowupfitness.comhttps://rss.buzzsprout.com/2175338.rsspodcastindex.org
A Healthy Shift | The Shift Work PodcastRoger Sutherland | Founder, A Healthy Shift | Night Shift & Sleep Specialist | Shift Work Educator421October 29, 2026Weeklypodcast.ahealthyshift.comhttps://rss.buzzsprout.com/1959372.rsspodcastindex.org
Flex Diet PodcastDr. Mike T Nelson417October 26, 2026Weeklyflex-diet-podcast.simplecast.comhttps://feeds.simplecast.com/_12E74LSpodcastindex.org
Power On Plants | Healthy Food, Christian, Entrepreneur, Energy, Inflammation, Weight Loss, Cholesterol, Menopause, Blood Pressure, Meal Prep Ideas, Vegan Food,Jarrod Roussel, PA-C and Anita Roussel, BSN415October 20, 2026Weeklypoweronplants.comhttps://rss.buzzsprout.com/1513852.rsspodcastindex.org
The FIT40 PodcastBryan Fitzsimmons414October 20, 2026Weeklybryanfitzsimmon.substack.com/s/the-fit40-podcastpodcastindex.org
Common Sense HealthCoach Stephen BSc Hons412October 29, 2026Several times a weektheukcarnivore.comhttps://api.riverside.fm/hosting/LeD3oNnD.rsspodcastindex.org
Stop Over-drinking and Start LivingAngela Mascenik - Certified Stop Over-drinking Coach410October 29, 2026Weeklyangelamascenik.com/podcasts/stop-over-drinking-and-start-livinghttps://app.kajabi.com/podcasts/2147493774/feedpodcastindex.org
The Ultimate Journey of Self-CareAlison Katschkowsky409October 27, 2026Weeklythealisonk.comhttps://feeds.captivate.fm/the-ultimate-journey-of/podcastindex.org
Digest ThisDigest This409October 21, 2026Weeklylilsipper.comhttps://feeds.megaphone.fm/SSM4324614055podcastindex.org
Nutrition with Judy | Holistic Health | CarnivoreJudy Cho408October 29, 2026Weeklynutritionwithjudy.com/nwj-podcasthttps://rss.buzzsprout.com/1848795.rsspodcastindex.org
The Gabby Reece ShowGabby Reece405October 26, 2026Weeklythegabbyreeceshow.substack.com/podcastpodcastindex.org
Vegan Fitness PodcastFritz Horstmann405October 30, 2026Every two weeksfritzhorstmann.comhttps://rss.buzzsprout.com/245815.rsspodcastindex.org
Direction Not Perfection - Mindset, Menopause & Sustainable Weight Loss for Women Over 40 with Dietitian, Lindsey HouseLindsey House RD403October 30, 2026Weeklyhealthaccountabilitycoach.com/podcast-1https://rss.buzzsprout.com/2504425.rsspodcastindex.org
Holistic Life NavigationHolistic Life Navigation402October 19, 2026Weeklyholisticlifenavigation.comhttps://rss.buzzsprout.com/278649.rsspodcastindex.org
Optimise Your Body with Martin SilvaOptimise Your Body with Martin Silva395October 31, 2026Every two weeksoptimiseyourbody.transistor.fmhttps://feeds.transistor.fm/optimise-your-body-with-martin-silvapodcastindex.org
The Healthy DiabeticCoach Ken Kniss395October 29, 2026Weeklysimplifyingdiabetes.com/podcasthttps://rss.buzzsprout.com/1187024.rsspodcastindex.org
PLANTSTRONG PodcastRip Esselstyn392October 29, 2026Weeklyplantstrongpodcast.comhttps://feeds.captivate.fm/plantstrong/podcastindex.org
Nutrition & LifeLisa Franz390October 30, 2026Weeklyrss.com/podcasts/nutrition-and-lifehttps://media.rss.com/nutrition-and-life/feed.xmlpodcastindex.org
Dr Alo ShowCardiologist & Personal Trainer Dr. Alo387October 22, 2026Several times a weekdralo.net/podcasts/dr-alo-showhttps://app.kajabi.com/podcasts/2147644595/feedpodcastindex.org
Eating at a MeetingTracy Stuckrath, CFPM, CMM, CSEP, CHC386October 27, 2026Weeklyeatingatameeting.comhttps://eatingatameeting.libsyn.com/rsspodcastindex.org
Eating at a MeetingTracy Stuckrath, CFPM, CMM, CSEP, CHC386October 27, 2026Weeklyeatingatameeting.comhttps://rss.libsyn.com/shows/289697/destinations/2261888.xmlpodcastindex.org
Diabetics Doing Things PodcastRob Howe384October 28, 2026Every two weeksdiabeticsdoingthings.com/podcasthttps://diabeticsdoingthings.com/podcast?format=RSSpodcastindex.org
Redefining Strength PodcastCori Lefkowith384October 31, 2026Weeklyredefiningstrength.com/podcasthttps://rss.buzzsprout.com/855202.rsspodcastindex.org
Anxiety Reset PodcastGeorgie Collinson384October 27, 2026Weeklygeorgiecollinson.comhttps://anxietyreset.libsyn.com/rsspodcastindex.org
Outsmart OvereatingLeslie Hooper384October 27, 2026Weeklyfatmurder.libsyn.com/websitehttps://fatmurder.libsyn.com/rsspodcastindex.org
Outsmart OvereatingLeslie Hooper384October 27, 2026Weeklyfatmurder.libsyn.com/websitehttps://rss.libsyn.com/shows/191255/destinations/1343021.xmlpodcastindex.org
ehealth radio networkeHealth Radio Network380October 30, 2026Weeklyspreaker.com/show/ehealth-radio-network_1https://www.spreaker.com/show/1797913/episodes/feedpodcastindex.org
Health, Wellth & Wisdom PodcastHealth, Wellth & Wisdom Podcast376October 30, 2026Weeklynutritioncoachingwithnicole.comhttps://anchor.fm/s/4d902250/podcast/rsspodcastindex.org
Revealing Wholeness with Dr.TroyDr. Troy Munson376October 29, 2026Every two weeksinfinitywholehealth.comhttps://www.spreaker.com/show/2885612/episodes/feedpodcastindex.org
The Evolving Wellness Podcast with Sarah Kleiner WellnessSarah Kleiner376October 30, 2026Weeklysarahkleinerwellness.com/courseshttps://anchor.fm/s/48b7c51c/podcast/rsspodcastindex.org
The Wealthy CoachKendra Perry | Health Business Mentor369October 26, 2026Weeklykendraperry.nethttps://rss.buzzsprout.com/2025996.rsspodcastindex.org
It's HERTIME with Cody SandersCody Sanders368October 27, 2026Weeklybuzzsprout.com/868171https://rss.buzzsprout.com/868171.rsspodcastindex.org
Hypnosis for Permanent Weight LossLeslie M. Thornton368October 26, 2026Weeklyhpwl.cohttps://hypnosisforpermanentweightloss.libsyn.com/rsspodcastindex.org
Wellness While WalkingCarolyn Cohen365October 28, 2026Weeklywellnesswhilewalking.comhttps://rss.libsyn.com/shows/231047/destinations/1704473.xmlpodcastindex.org
The Nutrition CouchSusie Burrell & Leanne Ward365October 27, 2026Weeklyiheart.com/podcast/269-the-nutrition-couch-86100031https://www.omnycontent.com/d/playlist/fa326977-3de5-4283-9b8b-af3500c58607/777f1745-099d-4802-82c2-af4600179e21/d0c97ea3-8664-4d8e-b202-af4600179e2a/podcast.rsspodcastindex.org
Thriving As A Physician: How to Lose Weight & Love Your LifeSiobhan Key364September 2, 2026Weeklyweightsolutionsforphysicians.ca/podcasthttps://weightsolutions.libsyn.com/rsspodcastindex.org
Living Life NaturallyLynne Wadsworth363October 26, 2026Weeklyholistic-healthandwellness.com/podcasthttps://living-life-naturally.libsyn.com/rsspodcastindex.org
Living Life NaturallyLynne Wadsworth363October 26, 2026Weeklyholistic-healthandwellness.com/podcasthttps://rss.pdrl.fm/9bc001/feeds.libsyn.com/280802/rss/?redirect=falsepodcastindex.org
ZOE Science & NutritionZOE362October 29, 2026Weeklyzoe.compodcastindex.org
Pharmacy FocusPharmacy Times361October 15, 2026Weeklypharmacytimes.com/podcastshttps://audioboom.com/channels/5027742.rsspodcastindex.org
Made For Living WellAlexa Schirm360October 22, 2026Every two weeksthelivingwell.comhttps://simplerootsradio.libsyn.com/rsspodcastindex.org
The Undiluted TruthMichael Farmer358October 29, 2026Weeklyredcircle.com/shows/the-undiluted-truthhttps://feeds.redcircle.com/3edac64f-f4ce-40b8-8e47-82b72cd8f726podcastindex.org
Vitality Unleashed: The Functional Medicine PodcastDr. Kumar from LifeWellMD.com358October 30, 2026Several times a weeklifewellmd.comhttps://rss.buzzsprout.com/2409652.rsspodcastindex.org
Lose Weight For The Last TimeLaura Conley355October 29, 2026Weeklylauraconley.comhttps://feeds.acast.com/public/shows/5f8cd6b255c4ff01ef49efe7podcastindex.org
Get Healthy AlabamaGeorge Burroughs350October 28, 2026Weeklygethealthyalabama.comhttps://drgeorge.libsyn.com/rsspodcastindex.org
The Reach Your Peak Experience (A Sports Nutrition Podcast)Aleksa the Sports Dietitian349October 29, 2026Every two weekstheclimbingdietitian.com.auhttps://rss.buzzsprout.com/265085.rsspodcastindex.org
Heavy Muscle RadioRXMUSCLE346October 26, 2026Weeklyrxmuscle.comhttps://rss.buzzsprout.com/1227455.rsspodcastindex.org
The Ageless and Awesome PodcastSusie Garden344October 26, 2026Every two weekssusiegarden.comhttps://rss.buzzsprout.com/2156548.rsspodcastindex.org
The Own It ShowThe Own It Show: Where Everyday People Take Ownership to Create Extraordinary Success343October 19, 2026Weeklyownitcoaching.comhttps://rss.buzzsprout.com/1003867.rsspodcastindex.org
Lifestyle Of Fitness PodcastLife of a Fighter342October 29, 2026Every two weekslifestyleoffitness.comhttps://rss.buzzsprout.com/50782.rsspodcastindex.org
What's Eating You Podcast with Clinical Psychologist Stephanie GeorgiouStephanie Georgiou (Mind Food Steph)342October 27, 2026Weeklystan.store/mindfoodstephpodcastindex.org
THE BETTER BELLY PODCAST - Natural Constipation Remedies, Acid Reflux, Hormones, Gut Health, Functional MedicineAllison Jordan FDN-P | Functional Gut Health Coach | Constipation and Bloat Expert340October 29, 2026Weeklybetterbellytherapies.com/podcasthttps://feeds.captivate.fm/better-belly-podcast/podcastindex.org
Your Longevity BlueprintDr. Stephanie Gray337October 28, 2026Weeklyyourlongevityblueprint.comhttps://feeds.megaphone.fm/HNNOE2189486182podcastindex.org
The Life Transformer ShowTara Hammett336October 28, 2026Weeklytarahammett.comhttps://lifetransformer.libsyn.com/rsspodcastindex.org
Truce with Food: The Psychology of Emotional Eating and Your Relationship with FoodAli Shapiro, MSOD, CHHC334October 21, 2026Every two weekstrucewithfood.com/podcasthttps://rss.buzzsprout.com/2287689.rsspodcastindex.org
Food Junkies PodcastClarissa Kennedy333October 22, 2026Weeklyfoodjunkies.libsyn.com/websitehttps://foodjunkies.libsyn.com/rsspodcastindex.org
The Powerhouse MentalityKaitlyn Kenna Smith333October 19, 2026Weeklybuzzsprout.com/1782904https://rss.buzzsprout.com/1782904.rsspodcastindex.org
Real Health and Weight Loss PodcastChris Ashmore332October 26, 2026Weeklyrlmedicine.comhttps://www.omnycontent.com/d/playlist/34440717-39e0-4c28-917a-ab9600268644/92e2997d-4748-4bfa-a558-ac700051e4a3/fd9a6afd-8919-4cd8-ac92-ac70005562f3/podcast.rsspodcastindex.org
Coffee With DudesAlex Wojciechowski and Matt DeJesus332October 28, 2026Weeklypodcasters.spotify.com/pod/show/optimizedyouhttps://anchor.fm/s/b9b2fc14/podcast/rsspodcastindex.org
Sound Bites A Nutrition PodcastMelissa Joy Dobbins329October 20, 2026Every two weekssoundbitesrd.comhttps://soundbites.libsyn.com/rsspodcastindex.org
Dietitian Side HustleKatie Dodd328October 28, 2026Weeklykatiedodd.libsyn.comhttps://katiedodd.libsyn.com/rsspodcastindex.org
Done with Dieting: Total Health for Women 40+ with Elizabeth ShermanElizabeth Sherman328October 27, 2026Weeklyelizabethsherman.com/category/podcasthttps://rss.buzzsprout.com/2562471.rsspodcastindex.org
Live Long with Peter BowesHealthspan Media327October 22, 2026Every two weekslivelongpodcast.comhttps://rss.buzzsprout.com/87724.rsspodcastindex.org
BIOptimizers - Awesome Health PodcastWade Lightheart319October 22, 2026Every two weeksbioptimizers.com/awesome-health-podcasthttps://awesomehealthpodcast.libsyn.com/rsspodcastindex.org
Breast Cancer ConversationsSurvivingBreastCancer.org317October 26, 2026Every two weekssurvivingbreastcancer.orghttps://rss.buzzsprout.com/1144085.rsspodcastindex.org
Nourished ConnectionsHealth Coach Heather317October 31, 2026Weeklyhealthcoachh.samcart.com/products/cozy-homemaker-circlehttps://rss.buzzsprout.com/848173.rsspodcastindex.org
The TrulyFit PodcastTrulyFit317August 25, 2026Weeklythe-trulyfit-podcast.onpodium.comhttps://rss.buzzsprout.com/1681549.rsspodcastindex.org
Kidney Stone DietSPYR317October 27, 2026Weeklykidneystonediet.comhttps://feeds.transistor.fm/kidney-stone-dietpodcastindex.org
A Magical Life: Health, Wealth, and Weight LossMagic Barclay315September 1, 2026Weeklywholisticnaturalhealth.com.auhttps://rss.buzzsprout.com/1156013.rsspodcastindex.org
Dietetics with DanaDana J. Fryer, MS, RDN, CNSC313October 20, 2026Weeklydanajfnutrition.comhttps://rss.buzzsprout.com/1967784.rsspodcastindex.org
Wellness Your Way with Dr. Megan LyonsDr. Megan Lyons, DCN311October 27, 2026Weeklybuzzsprout.com/1265507https://rss.buzzsprout.com/1265507.rsspodcastindex.org
Your Health University PodcastJamie Preston310October 26, 2026Every two weeksltchs.com/ltcuhttps://feeds.simplecast.com/m48dyvddpodcastindex.org
Cheers to Your Success!Ashley Fillmore310October 26, 2026Weeklymetabolicfix.com/podcasts/cheers-to-your-successhttps://app.kajabi.com/podcasts/2147487671/feedpodcastindex.org
Satiated PodcastStephanie Mara Fox308October 26, 2026Every two weeksstephaniemara.comhttps://rss.buzzsprout.com/809987.rsspodcastindex.org
Menopause UnscriptedFarah Kariamburi308October 26, 2026Every two weeksfarahkariamburi.comhttps://feeds.transistor.fm/menopause-unscripted-podcastpodcastindex.org
The Hard To Kill Podcast with Dave MorrowDavid Morrow307October 30, 2026Every two weekshardtokill.org/podcasthttps://feed.pod.co/the-hard-to-kill-podcastpodcastindex.org
The Consistency ProjectEC Synkowski306October 28, 2026Weeklyoptimizemenutrition.com/theconsistencyprojecthttps://anchor.fm/s/59c27528/podcast/rsspodcastindex.org
Fuel Her Awesome — Mental Health, Aging, Nutrition & Healing Your Relationship With Food: gut-brain connection, emotional eating, women’s hormone health, food fJessika Brown- Registered Dietitian, Empowered Eating Coach, Intuitive Eating Mentor, Boy Mom305October 5, 2026Weeklyjessbrownrd.comhttps://feed.podbean.com/jessbrownrd/feed.xmlpodcastindex.org
Optimal MetabolismShana Hussin, RDN304October 27, 2026Weeklyfasttoheal.infohttps://shanahussin.libsyn.com/rsspodcastindex.org
Weight Loss WinformationConnie Stapleton, Ph.D.304October 28, 2026Weeklypodcast.weightlosswinformation.comhttps://rss.buzzsprout.com/1605223.rsspodcastindex.org
Joyful EatingJules Clancy304October 26, 2026Weeklyjoyfuleating.podbean.comhttps://feed.podbean.com/joyfuleating/feed.xmlpodcastindex.org
Renegade Remission: Holistic Healing for Cancer, Heart Disease, Alzheimer's, Dementia, MS, ALSElanie Welch - Holistic Healing + Nutrition Expert304October 29, 2026Weeklytherenegadenutritionist.comhttps://feeds.captivate.fm/renegade-remission/podcastindex.org
Life After SugarNetta303October 25, 2026Weeklyaftersugarclub.comhttps://rss.buzzsprout.com/1499752.rsspodcastindex.org
Now and Then PodcastDr. Bart Precourt303October 29, 2026Weeklyhealthmadesimpleshow.libsyn.com/websitehttps://healthmadesimpleshow.libsyn.com/rsspodcastindex.org
Menopause MasteryDr. Betty Murray302October 28, 2026Weeklymenopausemasterypodcast.libsyn.com/sitehttps://feeds.libsyn.com/386309/rsspodcastindex.org
Menopause MasteryDr. Betty Murray302October 28, 2026Weeklymenopausemasterypodcast.libsyn.com/sitehttps://rss.libsyn.com/shows/386309/destinations/3177122.xmlpodcastindex.org
Meal Prep Monday Podcast™Allison Schaaf301October 26, 2026Every two weeksprepdish.com/podcasthttps://rss.libsyn.com/shows/228821/destinations/1684019.xmlpodcastindex.org
Dr. M's Women and Children First PodcastDr. Chris Magryta, "Dr. M"300October 25, 2026Weeklydocsmo.comhttps://www.docsmo.com/feed/podcast/podcastindex.org
The Workout Hero ShowMr Trainer man Erick300October 30, 2026Weeklyworkoutheroclub.comhttps://warriormotivation.libsyn.com/rsspodcastindex.org
Radio Fitness RevolucionarioMarcos Vázquez300October 29, 2026Weeklyfitnessrevolucionario.comhttps://www.fitnessrevolucionario.com/feed/podcastpodcastindex.org
Nutrition Facts with Dr. GregerMichael Greger, M.D. FACLM300October 29, 2026Weeklynutritionfacts.org/audiohttps://nutritionfacts.org/audio/feed/podcast/podcastindex.org
Nourish, Eat, RepeatAdrianne Delgado300October 27, 2026Weeklypodcast.show/nourish_eat_repeathttps://feeds.blubrry.com/feeds/nourish_eat_repeat.xmlpodcastindex.org
Whole Health Empowerment Project- healthy eating, weight loss after 40, weight loss motivation, food freedom, nutrition, womens health, healthy life hacks, womeTricia Stefankiewicz/Registered Dietitian, Nutritionist, Health Coach300October 29, 2026Weeklytriciard.comhttps://feed.podbean.com/wholehealthempowermentproject/feed.xmlpodcastindex.org
Food Freedom RadioAM950 Radio300October 22, 2026Every two weeksam950radio.com/category/podcasts/food-freedom-radiohttps://www.am950radio.com/category/podcasts/food-freedom-radio/feed/podcastindex.org
The LDN Radio Show About Low Dose NaltrexoneLinda Elsegood300October 21, 2026Weeklyldnresearchtrust.orghttps://feeds.captivate.fm/the-ldn-radio-show/podcastindex.org
The Fit Over 40 Podcast by TRINITYTRINITY Transformation300October 30, 2026Weeklytrinitytransformation.co.uk/series/the-fit-over-40-podcast-by-trinityhttps://trinitytransformation.co.uk/feed/podcast/podcastindex.org
Body Chat PodcastDr. Stephen Nedd: Chiropractic Physician | Educator | Sharing Over 25 Years of Knowledge on Alternative Health Solutions & Ron Nedd - Author, Innovator, Podcast Host & Realtor®300October 21, 2026Every two weeksbodychatpodcast.comhttps://bodychatpodcast.com/feed/podcast/podcastindex.org
TennesseeFarmTable.comTennessee Farm Table300October 30, 2026Every two weekstennesseefarmtable.comhttps://amy-campbell-lsuk.squarespace.com/new-blog?format=rsspodcastindex.org
The Healthification Podcast300October 18, 2026Every two weeksstrongbodygreenplanet.comhttps://strongbodygreenplanet.com/feed/podcast/podcastindex.org
The Drop Set with Darin Starr: Bodybuilding for the MassesFive Starr Physique300September 22, 2026Every two weeksfivestarrphysique.comhttps://feeds.podcastmirror.com/the-drop-setpodcastindex.org
The Darin Olien ShowDarin Olien300October 30, 2026Weeklysuperlife.comhttps://superlife.com/feed/podcast/podcastindex.org
Naturopathic Earth Radio & Holistic Health NewsGregory300October 27, 2026Every two weeksnaturopathicearth.comhttps://naturopathicearth.com/feed/podcast/podcastindex.org
HAPPILY HORMONAL | hormone balance for moms, PMS, painful periods, natural birth control, low energy, pro-metabolicLeisha Drews, RN, FDN-P, holistic hormone coach, period expert300October 26, 2026Weeklyhappilyhormonal.buzzsprout.comhttps://rss.buzzsprout.com/2037108.rsspodcastindex.org
Menopause Nutritionist PodcastChanel Stuck Nutrition300October 28, 2026Weeklychanelstuck.comhttps://chanelstuck.com/feed/podcast/podcastindex.org
Menopause Nutritionist PodcastChanel Stuck Nutrition300October 28, 2026Several times a weekchanelstuck.comhttps://feeds.blubrry.com/feeds/1471862.xmlpodcastindex.org
Podcasts Archives - Extreme Health Radio300October 26, 2026Dailyhttps://extremehealthradio.com/podcasts/feed/podcastindex.org
Naturally NourishedAli Miller RD299October 25, 2026Weeklyalimillerrd.com/podcasthttps://feed.podbean.com/alimillerrd/feed.xmlpodcastindex.org
Vanessa G FitcastVanessa Gillette299October 26, 2026Weeklyvanessa-g-fitcast.simplecast.comhttps://feeds.simplecast.com/A81LgAPBpodcastindex.org
Furthermore with Drs Michele & Mark SherwoodMaverick Broadcasting Network298October 30, 2026Weeklyspreaker.com/show/furthermore_1https://www.spreaker.com/show/5970211/episodes/feedpodcastindex.org
Real WW TalkReal WW Talk297October 31, 2026Weeklyrealwwtalk.buzzsprout.comhttps://rss.buzzsprout.com/1584829.rsspodcastindex.org
The Crackin' Backs PodcastDr. Terry Weyman and Dr. Spencer Baron296October 30, 2026Weeklycrackinbackspodcast.buzzsprout.comhttps://rss.buzzsprout.com/1828354.rsspodcastindex.org
Slimming World PodcastASFB Productions295October 26, 2026Every two weeksinstagram.com/slimmingworldpodcasthttps://audioboom.com/channels/5010283.rsspodcastindex.org
Healthy Eating For Smart WomenKat Rentas295October 30, 2026Weeklykatrentas.comhttps://katrentas.libsyn.com/rsspodcastindex.org
The Whole Body Detox ShowDavid DeHaas293October 25, 2026Every two weekslivingwaterscleanse.comhttps://rss.buzzsprout.com/772145.rsspodcastindex.org
From Corset to CrownCarrie Lupoli292October 27, 2026Every two weekscarrielupoli.com/podcasthttps://feeds.captivate.fm/carrie-lupoli/podcastindex.org
Iron Radio-Nutrition Radio NetworkDr Mike T Nelson291October 26, 2026Weeklynewassociates.orghttps://feeds.simplecast.com/Ar_bYLxmpodcastindex.org
FitBody LifestyleJami & Greg DeBernard289October 29, 2026Weeklyfitbodylifestylepodcast.comhttps://rss.buzzsprout.com/2306043.rsspodcastindex.org
The Fasting Method PodcastMegan Ramos Nutrition Inc288October 27, 2026Weeklythefastingmethod.comhttps://thefastingmethodpodcast.libsyn.com/rsspodcastindex.org
Tea & Herbal Fundamentals: Matcha, Loose-Leaf Brewing Tips & Health BenefitsAlbert Luna288October 26, 2026Several times a weeknaturopathicearth.comhttps://naturopathicearth.com/feed/https-naturopathicearth-com-fundamentalsoftea/podcastindex.org
FitMitTuro Fitness PodcastTuro Virta287October 29, 2026Every two weekspersonaltrainerturo.comhttps://rss.buzzsprout.com/2118479.rsspodcastindex.org
Rewilded WellnessLydia Joy287October 28, 2026Every two weekslydiajoy.mehttps://rss.buzzsprout.com/823249.rsspodcastindex.org
Stay Off My Operating TableDr. Philip Ovadia287October 27, 2026Weeklyifixhearts.comhttps://rss.buzzsprout.com/1810620.rsspodcastindex.org
No-Bullsh!t VeganKarina Inkster286October 13, 2026Every two weeksnobullshitvegan.comhttps://nobullshitvegan.libsyn.com/rsspodcastindex.org
Nutrition for Dancers with The Dance Nutritionist®Rachel Fine285October 26, 2026Every two weekspointenutrition.comhttps://anchor.fm/s/31a23a88/podcast/rsspodcastindex.org
The Kris Gethin PodcastKris Gethin283October 22, 2026Every two weekskrisgethin.comhttps://krisgethin.libsyn.com/rsspodcastindex.org
Hungry Girl: Chew the Right Thing!Audioboom280October 28, 2026Every two weekshungry-girl.comhttps://audioboom.com/channels/4959198.rsspodcastindex.org
Positively Anti-InflammatoryAlyssa K. Abrahamson278October 31, 2026Weeklythewellnessheadquarters.comhttps://rss.buzzsprout.com/1577293.rsspodcastindex.org
Fabulously KetoJackie Fletcher278October 29, 2026Every two weeksfabulouslyketo.com/series/fabulously-ketohttps://fabulouslyketo.com/feed/podcast/podcastindex.org
The Profitable NutritionistAndrea Nordling278October 28, 2026Weeklybuildaprofitablepractice.comhttps://rss.buzzsprout.com/1856959.rsspodcastindex.org
Diet Culture Rebel PodcastBonnie Roney277October 28, 2026Every two weeksdietculturerebel.comhttps://feeds.captivate.fm/diet-culture-rebel/podcastindex.org
Healthy Living ScottsdalePulse Fitness Scottsdale276October 1, 2026Every two weekshealthy-living-scottsdale.simplecast.comhttps://feeds.simplecast.com/NoBmCR4Kpodcastindex.org
The Nourished ChildJill Castle276October 29, 2026Every two weeksthenourishedchild.comhttps://thenourishedchild.libsyn.com/rsspodcastindex.org
Make Fit SimpleAndrea Allen276October 28, 2026Weeklyandreaallenmethod.libsyn.com/websitehttps://rss.buzzsprout.com/1778813.rsspodcastindex.org
Mastering MenopauseKathy Cote276October 26, 2026Weeklykatalystfitness.nethttps://rss.buzzsprout.com/1658926.rsspodcastindex.org
Aquademia: The Seafood PodcastThe Global Seafood Alliance275October 22, 2026Every two weeksthe-aquademia-podcast.simplecast.comhttps://feeds.simplecast.com/g5JeudWTpodcastindex.org
CBG RadioJustin Romaire274September 2, 2026Every two weeksconsistencybreedsgrowth.com/cbg-radiohttps://rss.buzzsprout.com/647050.rsspodcastindex.org
Making Shift Happen274October 30, 2026Weeklyshifthumanperformance.comhttps://shifthumanperformance.com/feed/podcast/podcastindex.org
Life Time TalksMolly Kopischke273October 29, 2026Every two weekslifetimetalks.libsyn.com/websitehttps://lifetimetalks.libsyn.com/rsspodcastindex.org
The Mindset and Metabolism PodcastJoey Gast272October 26, 2026Every two weeksbreakfastandbarbells.podbean.comhttps://api.riverside.fm/hosting/cNFjuuMo.rsspodcastindex.org
Rebuilding Trust With Your BodyKaty Harvey271October 27, 2026Weeklykatyharvey.net/podcasthttps://rebuildingtrustwithyourbody.libsyn.com/rsspodcastindex.org
Live Beyond the NormsChris Burres270October 23, 2026Weeklylivebeyondthenorms.comhttps://rss2.flightcast.com/l0t0zfky7ymswf6ermvnkmtu.xmlpodcastindex.org
Food with Mark BittmanSweetness and Light268October 28, 2026Weeklyshows.acast.com/6216896fd584d100134d4d24podcastindex.org
Triathlon Nutrition AcademyTaryn Richardson267October 29, 2026Weeklydietitianapproved.comhttps://www.omnycontent.com/d/playlist/d499bb1f-3fe7-49de-a681-aee000490499/55f737da-46e0-4d43-a226-aefb0060601f/6eef4fc0-c3a1-487f-a895-aefb0060604e/podcast.rsspodcastindex.org
Making Shift HappenJen Kates with Shift Human Performance266October 23, 2026Weeklyshifthumanperformance.comhttps://feeds.blubrry.com/feeds/makingshifthappen.xmlpodcastindex.org
Compassion & Cucumbers Vegan PodcastCompassion & Cucumbers265October 27, 2026Weeklycompassionandcucumbers.comhttps://rss.buzzsprout.com/1854430.rsspodcastindex.org
The World Vegan Travel PodcastBrighde Reed263October 26, 2026Every two weeksworldvegantravel.comhttps://rss.buzzsprout.com/703063.rsspodcastindex.org
A Gluten Free PodcastBen Hampton263October 25, 2026Weeklybuzzsprout.com/1867152https://rss.buzzsprout.com/1867152.rsspodcastindex.org
Cut The Crap With Beth And MattBeth Feraco And Matt Van Der Laar263October 26, 2026Weeklycutthecrappod.comhttps://www.spreaker.com/show/5185208/episodes/feedpodcastindex.org
Eating Habits for LifeKate Johnston261October 27, 2026Weeklykatemjohnston.comhttps://feeds.captivate.fm/eating-habits-for-life/podcastindex.org
Concierge Weight LossKara Hackleman, Certified Life & Weight Loss Coach260October 23, 2026Weeklycoachingkara.com/podcasts/concierge-weight-losshttps://app.kajabi.com/podcasts/2147496501/feedpodcastindex.org
Ayurveda & Psychology by Charlotte SkogsbergCharlotte Skogsberg259October 29, 2026Weeklybuzzsprout.com/1884333https://rss.buzzsprout.com/1884333.rsspodcastindex.org
MEfirst Midlife Badassery Podcast with Addie BeallAddie Beall | Midlife Badassery | Women over 40258October 23, 2026Every two weeksmidlifebadasserywithaddiebeall.buzzsprout.comhttps://rss.buzzsprout.com/1433275.rsspodcastindex.org
Peak Performance Life PodcastPeak Performance255October 27, 2026Every two weekslivepeakperformance.comhttps://peakperformancelife.libsyn.com/rsspodcastindex.org
Mastering Diabetes Audio ExperienceMastering Diabetes255October 23, 2026Every two weeksmasteringdiabetes.orghttps://masteringdiabetes.libsyn.com/rsspodcastindex.org
Create Your Shape with Jenny the NutritionistJenny254October 21, 2026Weeklyjennythenutritionist.com/create-your-shapehttps://rss.buzzsprout.com/1882362.rsspodcastindex.org
Thrive with Life PodcastRebecca Mansfield253August 5, 2026Weeklynutritionwithrebecca.co.ukhttps://anchor.fm/s/c0190274/podcast/rsspodcastindex.org
Natural Fertility with Dr. JaneDr. Jane Levesque252October 28, 2026Weeklydrjanelevesque.comhttps://feeds.captivate.fm/natural-fertility/podcastindex.org
Mind Your Midlife | Women Over 40, Menopause, Self Care, Mindset, Empty Nest, Aging Parents, Healthy Habits, Self-TalkCheryl Fischer, Life Coach for Midlife Women, Podcaster, Corporate Trainer252October 30, 2026Weeklymindyourmidlifepodcast.comhttps://rss.buzzsprout.com/2462838.rsspodcastindex.org
PaleoJays Smoothie CafeJay Bowers aka PaleoJay251October 9, 2026Every two weekspaleojay.comhttps://rss.buzzsprout.com/204436.rsspodcastindex.org
LifeMinute Health & WellnessAudioboom250October 21, 2026Monthlylifeminute.tv/healthhttps://audioboom.com/channels/4957137.rsspodcastindex.org
Herbal Womb WisdomKay'aleya Hunnybee250October 27, 2026Weeklyherbalwomb.comhttps://rss.buzzsprout.com/1105211.rsspodcastindex.org
Fat Loss School for Women Over 50 | Strategies to Lose Weight and Belly Fat After Menopause with Intermittent Fasting, Carb Cycling, Macros, Exercise, & MindsetAmy Bryan, FASTer Way to Fat Loss® Certified Weight Loss Coach250October 30, 2026Weeklyfatlossschool.podbean.comhttps://feed.podbean.com/fatlossschool/feed.xmlpodcastindex.org
Inspired Intentions PodcastInspired Intentions Podcast250October 26, 2026Every two weeksskyterrawellness.com/inspired-intentions-podcasthttps://skyterrawellness.com/feed/podcast/podcastindex.org
Protecting Your NEST with Dr. Tony HamptonDr. Tony Hampton249October 19, 2026Every two weeksdoctortonyhampton.comhttps://doctortonyhampton.libsyn.com/rsspodcastindex.org
Imperfect NutritionStefanie249October 26, 2026Every two weeksimperfectnutrition.buzzsprout.comhttps://rss.buzzsprout.com/1510816.rsspodcastindex.org
Generation Iron PodcastGeneration Iron248October 28, 2026Every two weeksgeneration-iron-podcast.simplecast.comhttps://feeds.simplecast.com/UJ5KKA_Ipodcastindex.org
The Autoimmune RESETVJ Hamilton248October 24, 2026Weeklytheautoimmuneforum.comhttps://rss.buzzsprout.com/2052963.rsspodcastindex.org
Maximized Living RadioDr. Rosie Main248October 28, 2026Every two weeksmainhealthsolutions.comhttps://rss.buzzsprout.com/2157186.rsspodcastindex.org
Wired2Win RadioChase Jackson247October 30, 2026Weeklyfeeds.acast.com/public/shows/superathlete-radiopodcastindex.org
Sue's Healthy Minutes with Sue Becker | The Bread BeckersSue Becker246October 26, 2026Weeklybreadbeckers.comhttps://feeds.libsyn.com/393404/rsspodcastindex.org
Faith-Filled Food Freedom | Disordered Eating, Body Image, Weight Loss Obsession, Anxiety, NutritionBrittany Braswell - Non-Diet Registered Dietitian for Christian Women246October 27, 2026Weeklybrittanybraswellrd.com/podcasthttps://anchor.fm/s/ce23c764/podcast/rsspodcastindex.org
Empowered!Robyn Chuter245October 23, 2026Weeklyrobynchuter.substack.com/podcastpodcastindex.org
Isn't She Powerful | Stop Food Noise & Sugar CravingsLaura Banks245October 28, 2026Weeklyisntshepowerful.buzzsprout.comhttps://rss.buzzsprout.com/2220368.rsspodcastindex.org
Spandex & WineRobin Hackney244October 30, 2026Weeklyspandexandwine.comhttps://rss.buzzsprout.com/2245410.rsspodcastindex.org
Inspire Health PodcastDr. Jason Loken, ND242October 26, 2026Every two weeksinspirehealthpodcast.comhttps://drjasonloken.libsyn.com/rsspodcastindex.org
Unshakeable Health with Thomas Hemingway, M.D.Thomas Hemingway, M.D.242October 29, 2026Every two weeksthomashemingway.buzzsprout.comhttps://rss.buzzsprout.com/912208.rsspodcastindex.org
The PricePlow PodcastSupplement Industry Thought Leaders241October 29, 2026Every two weeksblog.priceplow.com/podcasthttps://blog.priceplow.com/feed/podcastpodcastindex.org
Itchy and Bitchy PodcastMiller-Hnilica239October 26, 2026Every two weeksitchyandbitchy.comhttps://www.spreaker.com/show/4303608/episodes/feedpodcastindex.org
The Full Plate Podcast with Abbie Attwood, MSFull Plate by Abbie Attwood239October 27, 2026Weeklyabbieattwoodwellness.substack.com/podcastpodcastindex.org
Peak Human - Unbiased Nutrition Info for Optimum Health, Fitness & LivingBrian Sanders238October 29, 2026Every two weekspeak-human.comhttps://peakhuman.libsyn.com/rsspodcastindex.org
Speaking of Women's HealthSWH237October 28, 2026Weeklyspeakingofwomenshealth.comhttps://rss.buzzsprout.com/2084450.rsspodcastindex.org
Words of Wellness with ShellyShelly Jefferis237October 28, 2026Weeklywordsofwellnesswithshelly.buzzsprout.comhttps://rss.buzzsprout.com/2274191.rsspodcastindex.org
ReInvent HealthcareDr. Ritamarie Loscalzo236October 28, 2026Weeklyreinventhealthcare.comhttps://feeds.captivate.fm/reinvent-healthcare/podcastindex.org
Seems Like Diet CultureMallory Page, RD236October 29, 2026Weeklyliveunrestricted.mykajabi.com/podcasts/seems-like-diet-culture-2https://app.kajabi.com/podcasts/2147503798/feedpodcastindex.org
The Dr. Kinney ShowDr. Erin Kinney235October 19, 2026Every two weeksdrerinkinney.com/the-dr-kinney-showhttps://rss.buzzsprout.com/2088509.rsspodcastindex.org
The Menopause CoachAdele Johnston235October 29, 2026Weeklythemenopausecoach.transistor.fmhttps://feeds.transistor.fm/the-menopause-coachpodcastindex.org
LiftingLindsay's More Than FitnessLiftingLindsay, LLC234October 27, 2026Weeklyliftinglindsay.comhttps://feeds.transistor.fm/more-than-fitpodcastindex.org
The First Lady of Nutrition Podcast with Ann Louise Gittleman, Ph.D., C.N.S.Ann Louise Gittleman, Ph.D., C.N.S.233October 28, 2026Every two weeksannlouise.comhttps://annlouise.com/feed/podcast/podcastindex.org
Eat Train ProsperAaron Straker | Bryan Boorstein232October 24, 2026Every two weekseattrainprosper.comhttps://rss.buzzsprout.com/1556699.rsspodcastindex.org
Terminator Training ShowKevin Smith232October 31, 2026Weeklybuzzsprout.com/1958050https://rss.buzzsprout.com/1958050.rsspodcastindex.org
Nutrition for LittlesAlyssa Miller231August 26, 2026Every two weekshttps://admin.mamaandmerd.com/feed/podcast/podcastindex.org
Daily Brief PodcastAlbert Takem M.D231October 30, 2026Several times a weekbuzzsprout.com/2456729https://rss.buzzsprout.com/2456729.rsspodcastindex.org
Thyroid Mystery Solved: Hashimoto's and Hypothyroidism RevealedInna Topiler - MS, CNS230October 29, 2026Every two weeksinnatopiler.comhttps://feeds.transistor.fm/health-mysteries-solved-thyroid-and-hashimotos-revealedpodcastindex.org
NSCA’s Coaching PodcastNSCA230October 9, 2026Every two weeksnsca.com/Coaches/Podcasthttps://www.nsca.com/public-rss/Coaches/podcast/podcastindex.org
The Incredible JourneyGary Kent230October 30, 2026Every two weeksbuzzsprout.com/1774620https://rss.buzzsprout.com/1774620.rsspodcastindex.org
Understanding Disordered Eating: For anyone whose relationship with food feels harder than it shouldRachelle Heinemann229October 27, 2026Every two weeksrachelleheinemann.comhttps://understandingdisorderedeating.libsyn.com/rsspodcastindex.org
Keeping it Real with Nyree and FionaNyree Segui and Fiona Alford228October 27, 2026Every two weeksanchor.fm/nyree73https://rss.buzzsprout.com/1801537.rsspodcastindex.org
Brands for a Better World (formerly Evolve CPG)Gage Mitchell of Modern Species227August 27, 2026Every two weeksart19.com/shows/brands-for-a-better-worldhttps://rss.art19.com/brands-for-a-better-worldpodcastindex.org
Catch Ups In My KitchenGeorgia Symonds227October 27, 2026Weeklybuzzsprout.com/1928307podcastindex.org
Jacked Girl UniversityAimee Bartolo226October 29, 2026Every two weeksthefemalephysiquehub.mykajabi.com/podcasts/jacked-girl-universityhttps://app.kajabi.com/podcasts/2147487944/feedpodcastindex.org
Integrative Lyme Solutions with Dr. KarlfeldtDr. Michael Karlfeldt226October 26, 2026Every two weeksintegrative-lyme-solutions-with-dr-karlfeldt.castos.comhttps://feeds.transistor.fm/integrative-lyme-solutions-with-dr-karlfeldtpodcastindex.org
Root Cause Revolution PodcastAudrey Christie, ND-trad, MSN, RN224October 30, 2026Every two weeksaudreychristie.com/bloghttps://rss.buzzsprout.com/1535428.rsspodcastindex.org
Well2You PodcastSue McCarroll224October 20, 2026Every two weekswell2you.org/w2ypodcasthttps://rss.buzzsprout.com/1585855.rsspodcastindex.org
Live Unrestricted - The Intuitive Eating & Food Freedom PodcastSabrina Magnan224October 28, 2026Weeklyliveunrestrictedpodcast.buzzsprout.comhttps://rss.buzzsprout.com/2062269.rsspodcastindex.org
A GLP-1 Guide to Metabolic Health: The Plus SideZ PodcastKim Carlos224October 27, 2026Weeklytheplussidez.comhttps://rss.buzzsprout.com/2167931.rsspodcastindex.org
Mainly Plants PodcastRyan Furman223October 22, 2026Monthlymainlyplants.comhttp://feeds.feedburner.com/mainlyplants/yAOcpodcastindex.org
Simple Fitness Habits | Workout Plans, Health Habits, Functional Movement, Holistic Health, Home DetoxShaela Daugherty | Personal Trainer, Christian Fitness Coach, Christian Nutrition, Homeschool Mom223October 26, 2026Weeklythestrongerco.com/podcasts/simple-fitness-habits-workout-plans-health-habits-funhttps://app.kajabi.com/podcasts/2147507592/feedpodcastindex.org
Disrupting ObesityCharlotte Skanes222October 21, 2026Weeklydisruptingobesity.comhttps://rss.buzzsprout.com/2237789.rsspodcastindex.org
The Feeling Lighter PodcastWeShape221October 28, 2026Weeklyweshape.comhttps://feeds.captivate.fm/feelinglighter/podcastindex.org
Real WellnessSheri Traxler220October 30, 2026Weeklyshows.acast.com/real-wellnesspodcastindex.org
Sarasota Memorial HealthCastsSarasota Memorial HealthCasts219October 22, 2026Every two weekssmh.com/podcasthttps://feeds.simplecast.com/D2kMwduepodcastindex.org
The Infinite ProjectStephen Gauld219October 29, 2026Weeklyinfiniteproject.com/infinite90https://feeds.transistor.fm/the-infinite-projectpodcastindex.org
Christian Healthy Lifestyle: Health Tips That Promote Wellness - Longevity - Fitness - Mental Health and Spiritual GrowthDavid Sandstrom218September 30, 2026Every two weekschristianhealthylifestyle.mykajabi.com/podcasts/christian-healthy-lifestyle-healhttps://app.kajabi.com/podcasts/2147953281/feedpodcastindex.org
Muscle Science for WomenAshleigh VanHouten | Rachel Gregory218October 27, 2026Every two weeksmusclescienceforwomen.comhttps://paleomagazine.libsyn.com/rsspodcastindex.org
Dietitian ValuesLaura Jean218October 22, 2026Every two weeksdietitianvalues.buzzsprout.comhttps://rss.buzzsprout.com/1773663.rsspodcastindex.org
The DNA Talks PodcastThe DNA Company218October 28, 2026Every two weeksbuzzsprout.com/1870029https://rss.buzzsprout.com/1870029.rsspodcastindex.org
The Gymnast Nutritionist® PodcastChristina Anderson MS, RDN, CSSD, CSP218October 26, 2026Weeklychristinaandersonrdn.comhttps://rss.buzzsprout.com/2027449.rsspodcastindex.org
One Small BiteDavid Orozco217October 28, 2026Every two weeksonesmallbite.nethttps://rss.buzzsprout.com/679691.rsspodcastindex.org
Feisty Women's PerformanceDr. Erin Ayala217October 26, 2026Every two weekslivefeisty.com/category/podcasts/feisty-womens-performance-podcasthttps://feeds.captivate.fm/the-womens-performance-podcast/podcastindex.org
Nutritional Revolution Podcast with Kyla Channell, MScKyla Channell, MSc Nutrition & Human Performance216October 28, 2026Every two weeksnutritional-revolution.comhttps://rss.buzzsprout.com/986440.rsspodcastindex.org
Fit Mother Project PodcastFit Mother Project216October 30, 2026Every two weeksfitmotherproject.comhttps://feeds.captivate.fm/fit-mother-project/podcastindex.org
IF MAMA AIN’T HEALTHY (AIN’T NOBODY HEALTHY) - Christian Wellness, Metabolic Health, Functional Health, Christian Women’s Functional Health Coaching - formerly Lori Morris, CNM, MSN - Lori Morris | Christian Midwife & Faith-Based Wellness Coach216October 27, 2026Weeklyyourbirthgodsway.podbean.comhttps://yourbirthgodsway.podbean.com/feed.xmlpodcastindex.org
IF MAMA AIN’T HEALTHY (AIN’T NOBODY HEALTHY) - Christian Wellness, Metabolic Health, Functional Health, Christian Women’s Functional Health Coaching - formerly Lori Morris, CNM, MSN - Lori Morris | Christian Midwife & Faith-Based Wellness Coach216October 27, 2026Weeklyyourbirthgodsway.podbean.comhttps://feed.podbean.com/yourbirthgodsway/feed.xmlpodcastindex.org
Reproductive RebelAdrienne Irizarry, HWH215October 27, 2026Weeklymoonessence.lifehttps://rss.buzzsprout.com/2087965.rsspodcastindex.org
Binge Eating Dietitian PodcastDr. Joanne Moscalu Ed.D RD214October 22, 2026Every two weeksbingeeatingdietitian.comhttps://rss.buzzsprout.com/1519369.rsspodcastindex.org
The Midlife FeastJenn Salib Huber RD ND213October 26, 2026Every two weeksjennsalibhuber.cahttps://rss.buzzsprout.com/1851576.rsspodcastindex.org
Extend Podcast with Darshan Shah, MDDarshan Shah, MD213October 29, 2026Several times a weekdrshah.comhttps://feeds.libsyn.com/551312/rsspodcastindex.org
Other Side LifestyleJIm Hallinan and Aram Grigorian212October 29, 2026Weeklysites.libsyn.com/410084https://rss.libsyn.com/shows/410084/destinations/3396425.xmlpodcastindex.org
The Dr. Francavilla ShowDr. Francavilla208October 26, 2026Weeklybuzzsprout.com/2079861https://rss.buzzsprout.com/2079861.rsspodcastindex.org
Binge Eating BreakthroughJane Pilger208October 28, 2026Weeklyjanepilger.com/podcasthttps://rss.buzzsprout.com/2069013.rsspodcastindex.org
Free Podcasts | Indoor Cycle Instructor Podcast | ICI/PRO Premium EducationJohn Macgowan207August 22, 2026Monthlyindoorcycleinstructor.comhttp://feeds.feedburner.com/IndoorCycleFreePodcastpodcastindex.org
MusclesMascaraMotherhoodDamilola Bode-Ogundipe207October 15, 2026Weeklybuzzsprout.com/2170885https://rss.buzzsprout.com/2170885.rsspodcastindex.org
Nutrition Prescription: Wellness vs MedicationsDr. Steve Hughlett206October 26, 2026Weeklydrstevehughlett.comhttps://feeds.libsyn.com/431169/rsspodcastindex.org
The Healing CatalystDr. Avanti Kumar Singh205October 6, 2026Every two weeksavantikumarsingh.com/podcast-contenthttps://feeds.captivate.fm/the-healing-catalyst/podcastindex.org
Menopause Reimagined with Andrea DonskyAndrea Donsky, nutritionist205October 16, 2026Every two weeksmenopausereimagined.buzzsprout.comhttps://rss.buzzsprout.com/1374700.rsspodcastindex.org
The Coaches Corner University PodcastPaul Oneid205October 29, 2026Weeklycoachescorneru.mykajabi.com/podcasts/the-coaches-corner-university-podcasthttps://app.kajabi.com/podcasts/2147522858/feedpodcastindex.org
Foodnourish Deep DivesPavlos Giorkas205October 23, 2026Several times a weekfoodnourish.nethttps://www.spreaker.com/show/6602003/episodes/feedpodcastindex.org
Reclaim Your PlateSamantha Lee203August 19, 2026Every two weeksoffers.superlysam.com/podcasts/reclaim-your-platehttps://app.kajabi.com/podcasts/2147527015/feedpodcastindex.org
The Obesity Doctor PodcastDr. Sasha High203October 26, 2026Every two weekssashahighmd.com/podcasts/the-obesity-doctor-podcasthttps://app.kajabi.com/podcasts/2147487629/feedpodcastindex.org
Becoming ElliBecoming Elli201October 27, 2026Every two weeksbecomingelli.comhttps://becomingelli.libsyn.com/rsspodcastindex.org
scigest - Bioeconomy Science Institute podcastsNew Zealand Institute for Bioeconomy Science Limited201October 23, 2026Monthlygithub.com/dylang/node-rsshttps://www.plantandfood.com/rss-podcasts.xmlpodcastindex.org
Wabi Sabi - The Perfectly Imperfect Podcast with Candice KumaiCandice Kumai201October 6, 2026Every two weekscandicekumai.comhttps://feeds.simplecast.com/c38oFjnPpodcastindex.org
Get Your Goal BodyHilary Carver201October 27, 2026Weeklybuzzsprout.com/2026103https://rss.buzzsprout.com/2026103.rsspodcastindex.org
All You Can EatTom Shattuck201October 25, 2026Weeklyfeeds.acast.com/public/shows/all-you-can-eatpodcastindex.org
STEM-TalkDawn Kernagis and Ken Ford200October 26, 2026Monthlyihmc.us/stemtalkhttps://www.ihmc.us/stemtalk/feed/podcast/podcastindex.org
Fab Female NutritionWendy Hill200October 28, 2026Every two weekshillstart.me.uk/podcasthttps://ditchthediet.libsyn.com/rsspodcastindex.org
The Munro Method ClancastJason Munro200September 3, 2026Every two weeksmunronutrition.com/podcasts/the-munro-method-clancasthttps://app.kajabi.com/podcasts/2147510778/feedpodcastindex.org
Herbs with RosaleeRosalee de la Forêt200October 28, 2026Weeklyherbs-with-rosalee.captivate.fmhttps://feeds.captivate.fm/herbs-with-rosalee/podcastindex.org
The Plant Free MD with Dr Anthony ChaffeeAnthony Chaffee, MD200October 15, 2026Weeklyyoutube.com/channel/UCzoRyR_nlesKZuOlEjWRXQQhttps://feeds.libsyn.com/387443/rsspodcastindex.org
The Dr. Ardis Show PodcastDr Bryan Ardis200October 28, 2026Every two weeksthedrardisshow.libsyn.com/websitehttps://feeds.libsyn.com/295001/rsspodcastindex.org
Delay and PrayBeth The Catholic Fasting Coach200September 24, 2026Weeklythecatholicfastingcoach.comhttps://feeds.captivate.fm/delay-and-pray/podcastindex.org
Nourishing Nuggetstveenverano200October 26, 2026Weeklytveenverano.podbean.comhttps://feed.podbean.com/tveenverano/feed.xmlpodcastindex.org
Nourishing Nuggetstveenverano200October 26, 2026Weeklytveenverano.podbean.comhttps://tveenverano.podbean.com/feed.xmlpodcastindex.org
Migraine HeroesDiane Ducarme200October 28, 2026Weeklymigraineheroes.comhttps://feeds.captivate.fm/migraine-heroes-chron/podcastindex.org
'Booch News199October 16, 2026Every two weeksboochnews.comhttps://boochnews.com/feed/podcast/podcastindex.org
Live Purely with ElizabethElizabeth Stein199September 9, 2026Every two weekspurelyelizabeth.com/pages/live-purely-podcasthttps://feeds.simplecast.com/r7PBX_wMpodcastindex.org
Keto/Carnivore ConversationsRobert Kiltz MD.199October 30, 2026Weeklycnyfertility.com/our-team-members/dr-robert-kiltzhttps://anchor.fm/s/93697768/podcast/rsspodcastindex.org
Mindful ShapePaula Parker198October 28, 2026Every two weeksmindfulshape.comhttps://rss.buzzsprout.com/840805.rsspodcastindex.org
Beyond the BodyChristina Slater198October 29, 2026Every two weeksbeyond-the-body.sounder.fmpodcastindex.org
The PCOS Repair PodcastAshlene198October 20, 2026Every two weeksnourishedtohealthy.com/the-pcos-repair-podcasthttps://rss.buzzsprout.com/1966861.rsspodcastindex.org
Fertility In Focus PodcastDr. Christina Burns197October 8, 2026Every two weeksbuzzsprout.com/1742655https://rss.buzzsprout.com/1742655.rsspodcastindex.org
The Weighting Room PodcastChris & Lisa196August 13, 2026Every two weekstheweightingroom.buzzsprout.comhttps://rss.buzzsprout.com/1799703.rsspodcastindex.org
Chef Riq’s Unseen Cuisine | Sensory Cooking PodcastChef Riq196October 23, 2026Several times a weekpodcast.unseencuisine.comhttps://rss.buzzsprout.com/2537753.rsspodcastindex.org
Healthy Living by Giant PodcastGiant Food195October 30, 2026Every two weekssites.libsyn.com/141575/HealthyLivingPodcasthttps://nutritionmadeeasy.libsyn.com/rsspodcastindex.org
EmPowered RadioEmma Montgomery195October 26, 2026Every two weeksmacroswithem.comhttps://rss.buzzsprout.com/1297109.rsspodcastindex.org
Capable & Worthy: Fitness, Nutrition, & Mindset for People Who Don't Want Life to SuckIris & Amy195October 26, 2026Weeklypodcast.show/1471014https://feeds.blubrry.com/feeds/1471014.xmlpodcastindex.org
Simple Health for Moms (Sustainable Fitness & Hormone Health)Camille Beckstrand195October 28, 2026Weeklymommytummyfix.comhttps://feeds.captivate.fm/simple-health-for-moms/podcastindex.org
wise athletes podcastwise athlete podcast195August 21, 2026Every two weekswiseathletes.comhttps://www.wiseathletes.com/feed/podcast/podcastindex.org
CARNIVORE EVOLUTIONMark Ennis and Victoria Olson195October 29, 2026Weeklypodcasters.spotify.com/pod/show/victoria-olson2https://anchor.fm/s/fcab16b4/podcast/rsspodcastindex.org
PAC Talk with Pieter VoddenPieter Vodden194October 30, 2026Every two weeksshows.acast.com/pharos-fit-podcastpodcastindex.org
wise athleteswise athlete podcast194August 21, 2026Every two weekswiseathletes.com/series/wiseathleteshttps://www.wiseathletes.com/feed/podcast/wiseathletes/podcastindex.org
Brain ShamanMichael Waite194October 28, 2026Weeklybrainshaman.comhttps://rss.buzzsprout.com/2067421.rsspodcastindex.org
The Identity ArchitectGreg Fearon - The Identity Architect193September 8, 2026Monthlygregfearon.co.ukhttps://rss.buzzsprout.com/2604175.rsspodcastindex.org
Radical Health RadioHeart & Soil193October 28, 2026Weeklyradicalhealthradio.comhttps://feeds.megaphone.fm/radicalhealthradiopodcastindex.org
Feel Better. Live Free. | Healthy Weight Loss & Wellness for Midlife WomenLisa Joy Thompson193October 30, 2026Weeklythinlicious.comhttps://rss.buzzsprout.com/2194061.rsspodcastindex.org
What's the Root Cause? by Dr Vikki PetersenRoot Cause Medical Clinic191October 9, 2026Every two weeksrootcausemedicalclinics.comhttps://rss.buzzsprout.com/226881.rsspodcastindex.org
The Alternative Dog MomsKimberly Gauthier (Raw Feeder Life) and Erin Scott (Believe in Dog)191September 28, 2026Every two weeksalternativedogmoms.buzzsprout.comhttps://rss.buzzsprout.com/1955775.rsspodcastindex.org
The Kate Hamilton PodcastKate Hamilton Health191October 26, 2026Every two weekslinktr.ee/katehamiltonhealthhttps://feeds.zencastr.com/f/XgBKFOqM.rsspodcastindex.org
Strong Not StarvingMarcus Kain190October 20, 2026Every two weeksbuzzsprout.com/1807150https://rss.buzzsprout.com/1807150.rsspodcastindex.org
Defiant Health Radio with Dr. William DavisWilliam Davis, MD190October 27, 2026Every two weeksdrdavisinfinitehealth.comhttps://rss.buzzsprout.com/1795054.rsspodcastindex.org
Raised in the WoodsCivic Media190October 3, 2026Every two weekscivicmedia.us/shows/raised-in-wiscohttps://civicmedia.us/feed/podcast/raised-in-wisco/podcastindex.org
Eat More Carbs | A Period Recovery PodcastReilly Beatty MS, RD, CSSD and Jenna Fisher RD190October 29, 2026Weeklyreillybeatty.comhttps://anchor.fm/s/d4717e54/podcast/rsspodcastindex.org
Mocktail MinutesBaylee and Brianna189October 29, 2026Weeklymocktailminutes.buzzsprout.comhttps://rss.buzzsprout.com/2145831.rsspodcastindex.org
Eating For YouSallyanne Pisk188October 26, 2026Weeklyeatingforyou.com.auhttps://anchor.fm/s/b0e0f5c8/podcast/rsspodcastindex.org
Healthy As A MotherDr. Morgan MacDermott & Dr. Leah Gordon188October 28, 2026Weeklycohostpodcasting.comhttps://feeds.cohostpodcasting.com/MQNyj2Aapodcastindex.org
Exam Room Nutrition: Practical Nutrition for Healthcare ProfessionalsColleen Sloan, PA-C, RDN | Nutrition Educator187October 28, 2026Weeklyexamroomnutrition.buzzsprout.comhttps://rss.buzzsprout.com/2201560.rsspodcastindex.org
The Dr. Jules Plant-Based PodcastDr. Jules Cormier (MD)187October 25, 2026Weeklyplantbaseddrjules.comhttps://rss.buzzsprout.com/2209894.rsspodcastindex.org
Plant Based Eating Made Easy | Simple Strategies & Clear Nutrition Guidance to Transform Your Health | Dietitian, Plant-Based DietAnna Tseng MPH RD LDN | Registered Dietitian, Plant Based Coach, Plant-Based Diet Transition Expert, Plantbased Diet186October 27, 2026Weeklyplantnourished.comhttps://feed.podbean.com/plantbasedeatingmadeeasy/feed.xmlpodcastindex.org
Plant Based Eating Made Easy | Simple Strategies & Clear Nutrition Guidance to Transform Your Health | Dietitian, Plant-Based DietAnna Tseng MPH RD LDN | Registered Dietitian, Plant Based Coach, Plant-Based Diet Transition Expert, Plantbased Diet186October 27, 2026Weeklyplantnourished.comhttps://plantbasedeatingmadeeasy.podbean.com/feed.xmlpodcastindex.org
Suburban WarriorCrissy Pyfer185October 20, 2026Every two weekssuburbanwarriorpodcast.comhttps://rss.buzzsprout.com/753779.rsspodcastindex.org
Be Well with Dr. Michelle GreenwellDr. Michelle Greenwell185October 7, 2026Every two weeksbewellwithmichellegreenwell.buzzsprout.comhttps://rss.buzzsprout.com/1392208.rsspodcastindex.org
1% Better Podcast – Health Coaching & Positive Mindset for Women Over 40Jason Cook - Health Coaching for Women Over 40185October 27, 2026Weekly1-percent-better.simplecast.comhttps://feeds.simplecast.com/2FjP6lPrpodcastindex.org
Ending Body Burnout ShowChris & Filipa Bellette185October 26, 2026Weeklychrisandfilly.fm/podcasts/ending-body-burnout-showhttps://app.kajabi.com/podcasts/2147506185/feedpodcastindex.org
Plant Based Eating for HealthKathleen Gage183October 27, 2026Every two weeksveganvisibility.com/plant-based-eating-podcasthttps://plantbasedeatingforhealth.libsyn.com/rsspodcastindex.org
The Fit & Free PodcastLaura Swingler183October 27, 2026Every two weekslauraswingler.com/podcasts/the-fit-free-podcast-2https://app.kajabi.com/podcasts/2147507378/feedpodcastindex.org
The CrossFit Max PodcastCrossFit Max183October 21, 2026Weeklycrossfitmax.mykajabi.com/podcasts/the-crossfit-max-podcasthttps://app.kajabi.com/podcasts/2148107958/feedpodcastindex.org
Breaking Free PodcastNathan Francis182September 26, 2026Weeklybreaking-free-podcast.simplecast.comhttps://feeds.simplecast.com/1mPwsb95podcastindex.org
Find Food FreedomSam Previte181October 28, 2026Weeklybleav.com/shows/find-food-freedomhttps://anchor.fm/s/11288c684/podcast/rsspodcastindex.org
The Functional Fueling® PodcastLauren Papanos181October 21, 2026Every two weekssupportih.podbean.comhttps://feed.podbean.com/supportih/feed.xmlpodcastindex.org
Smart Weight Loss Coaching | Nutrition, Mindset and Fitness Tips for Women Who Want To Level Up Their Health, Wellness and LongevityLisa Oldson, MD | Weight Loss Coach181October 30, 2026Weeklysmartweightlosscoaching.comhttps://rss.buzzsprout.com/2171999.rsspodcastindex.org
The Grit & Grace Podcast with Dr. Lori DoddyLori Doddy181October 29, 2026Weeklylinktr.ee/lori.doddyhttps://feeds.libsyn.com/470739/rsspodcastindex.org
Fueling Endurance - Nutrition for Runners, Cyclists & TriathletesAlan McCubbin180September 27, 2026Every two weeksthelongmunch.podbean.comhttps://feed.podbean.com/thelongmunch/feed.xmlpodcastindex.org
The Integrative Health Podcast with Dr. JenDr. Jen180October 27, 2026Every two weekspflegmed.comhttps://rss.buzzsprout.com/1504159.rsspodcastindex.org
Between 2 PastriesNicole Kerneen and Annie Weiss179October 29, 2026Every two weeksspreaker.com/podcast/between-2-pastries--4243360https://www.spreaker.com/show/4243360/episodes/feedpodcastindex.org
Feel Light Mind & BodyClarenda179October 27, 2026Every two weeksclarendasempowerment.comhttps://rss.buzzsprout.com/2077250.rsspodcastindex.org
Clear Acne Naturally - Detoxing with DaniDanielle Ferguson178October 7, 2026Monthlydetoxingwithdani.comhttps://detoxingwithdani.libsyn.com/rsspodcastindex.org
Makes Milk with Emma Pickett: breastfeeding from the beginning to the endEmma Pickett - Board Certified Lactation Consultant178October 27, 2026Weeklyemmapickettbreastfeedingsupport.comhttps://rss.buzzsprout.com/2214940.rsspodcastindex.org
Living On MissionRachel Mitchell177October 28, 2026Every two weekslivingonmission.buzzsprout.comhttps://rss.buzzsprout.com/1800123.rsspodcastindex.org
GUT TALK with Jill & JennaJill and Jenna177October 29, 2026Every two weeksredcircle.com/shows/gut-talk-with-jill-and-jennahttps://feeds.redcircle.com/eccb5116-8d25-4cb7-bc5a-fc119dcbd306podcastindex.org
The Dr. Joey Munoz ShowDr. Joseph Munoz177October 19, 2026Weeklysites.libsyn.com/468747https://feeds.libsyn.com/468747/rsspodcastindex.org
Unfiltered Fit LifeNathalia Melo177October 28, 2026Weeklynathaliamelofit.comhttps://rss.buzzsprout.com/2060746.rsspodcastindex.org
The Dr. Joey Munoz ShowDr. Joseph Munoz177October 19, 2026Weeklysites.libsyn.com/468747https://rss.pdrl.fm/523327/feeds.libsyn.com/468747/rss/?redirect=falsepodcastindex.org
Dish On Ditching DietsSkinny Fitalicious176October 19, 2026Every two weeksskinnyfitalicious.comhttps://skinnyfitalicious.libsyn.com/rsspodcastindex.org
Holley Fueled Nutrition PodcastHolley Samuel174October 23, 2026Every two weeksholleyfuelednutrition.comhttps://anchor.fm/s/1fc6d1ac/podcast/rsspodcastindex.org
PATH Positive Approaches To Health174October 29, 2026Monthlypodomatic.com/podcasts/pathpodhttps://pathpod.podomatic.com/rss2.xmlpodcastindex.org
The Tara Thorne Wellness PodcastTara Thorne174October 20, 2026Every two weekstarathornenutrition.comhttps://feeds.libsyn.com/425186/rsspodcastindex.org
The Vibrant Wellness PodcastVibrant Wellness174September 23, 2026Weeklyvibrantwellnesspodcast.buzzsprout.comhttps://rss.buzzsprout.com/2139049.rsspodcastindex.org
The Primal PodcastRina Ahluwalia173October 25, 2026Every two weekstheprimal.comhttps://anchor.fm/s/a9285e5c/podcast/rsspodcastindex.org
Open-Minded HealingMarla Miller172September 29, 2026Every two weekspodcast.openmindedhealing.comhttps://rss.buzzsprout.com/1799937.rsspodcastindex.org
IBS Nutrition, Digestion & Gut Health: Inside Knowledge for people with IBSAnna Mapson IBS nutritionist172October 27, 2026Weeklygoodnessme-nutrition.com/inside-knowledge-for-ibshttps://feeds.captivate.fm/inside-knowledge/podcastindex.org
GialloZafferano.comMondadori Digital S.p.A.172October 29, 2026Several times a weekspreaker.com/podcast/giallozafferano-com--6822019https://www.spreaker.com/show/6822019/episodes/feedpodcastindex.org
Keep It ClearKatie Stewart, RHN & Cris Brown, RHN171October 7, 2026Weeklykatiestewartwellness.comhttps://feeds.transistor.fm/keep-it-clearpodcastindex.org
Sathiavani Wellness PodcastSATHIASEELAN N171October 31, 2026Weeklysathiavani.comhttps://anchor.fm/s/101db18a0/podcast/rsspodcastindex.org
Herb Mentor RadioLearningHerbs.com170October 28, 2026Monthlylearningherbs.com/podcasts/herb-mentor-radiohttps://app.kajabi.com/podcasts/2147744347/feedpodcastindex.org
The Laneway Podcast - On TourAsh Lane & Brad Lane170October 28, 2026Every two weeksthelanewaypodcast.buzzsprout.comhttps://rss.buzzsprout.com/1720097.rsspodcastindex.org
I'm Hormonal | Hormone balance, gut health & nutrition insightsBridget Walton, Women's Hormone Coach170August 24, 2026Weeklyimhormonal.buzzsprout.comhttps://rss.buzzsprout.com/2244665.rsspodcastindex.org
Fuel for the SoleFuel for the Sole169October 27, 2026Every two weekspodcasters.spotify.com/pod/show/fuelforthesolehttps://anchor.fm/s/579a0680/podcast/rsspodcastindex.org
Fast Metabolism Matters with Haylie PomroyHaylie Pomroy169October 27, 2026Every two weekssites.libsyn.com/452424https://feeds.libsyn.com/452424/rsspodcastindex.org
The Metabolic Classroom with Dr. Ben BikmanJack Hadley168October 26, 2026Every two weeksinsuliniq.compodcastindex.org
Grace Filled Food FreedomBrandice Lardner168October 19, 2026Every two weeksgrace-filled-plate.mykajabi.com/podcasts/grace-filled-food-freedomhttps://app.kajabi.com/podcasts/2147486755/feedpodcastindex.org
Find Your Edge: Training, Nutrition + Longevity for Endurance AthletesChris Newport | The Endurance Edge167October 29, 2026Every two weeksfindyouredgepodcast.comhttps://rss.buzzsprout.com/942688.rsspodcastindex.org
Frontline HealthTroy Duell167October 26, 2026Every two weeksfrontlinehealth.buzzsprout.comhttps://rss.buzzsprout.com/2031666.rsspodcastindex.org
Strong Like a MotherTiffany Wickes166October 26, 2026Weeklybuzzsprout.com/2193555https://rss.buzzsprout.com/2193555.rsspodcastindex.org
Wishing You Well with Maria PatrickMaria166October 29, 2026Weeklyqigongwithmaria.comhttps://rss.buzzsprout.com/2239735.rsspodcastindex.org
Rooted & WildHenry Hawk166October 31, 2026Several times a weekhenry-hawk.comhttps://rss.buzzsprout.com/2516751.rsspodcastindex.org
The Mindset DietIman Whyte165October 30, 2026Every two weeksfacebook.com/groups/153434106803048https://rss.buzzsprout.com/2067721.rsspodcastindex.org
The Willetts PodcastMaverick Willett165October 26, 2026Every two weeksfeeds.acast.com/public/shows/the-revenge-body-podcastpodcastindex.org
The Omni Dental PodcastDr. Bilus Poles165October 29, 2026Several times a weekomnidental.buzzsprout.comhttps://rss.buzzsprout.com/2471950.rsspodcastindex.org
Fit Habit LifeEmma Kirchner165October 29, 2026Weeklyfithabitemma.substack.com/podcastpodcastindex.org
Joint Dynamics Podcast - The Intelligent Movement SeriesJoint Dynamics164October 26, 2026Every two weeksjointdynamics.com.hkhttps://rss.buzzsprout.com/1233659.rsspodcastindex.org
Kelly's Kounts MacrosKelly Mozdy164October 26, 2026Weeklykellykountsmacros.buzzsprout.comhttps://rss.buzzsprout.com/2231741.rsspodcastindex.org
The You4ia Health PodcastMatt Sipala and Noah Barone163August 30, 2026Monthlyweeklydoseofyou4ia.podbean.comhttps://feed.podbean.com/you4iahealthpodcast/feed.xmlpodcastindex.org
Dr. Joe Galati PodcastDr Joe Galati163October 19, 2026Monthlydrjoegalati.compodcastindex.org
Real Health PodcastDr. Amir Rashidian162October 26, 2026Weeklysites.libsyn.com/554842https://rss.libsyn.com/shows/554842/destinations/4791727.xmlpodcastindex.org
It's Not JUST Menopause: GLP-1 Support, Fat Loss, & Hormone Solutions for Women in MidlifeCindi Stickle161October 25, 2026Every two weekscindistickle.comhttps://feeds.captivate.fm/its-not-just-menopause/podcastindex.org
The Beating Diabetes Lifestyle Podcast With Oscar CamejoOscar Camejo161October 26, 2026Every two weeksbeatingdiabeteslifestyle.buzzsprout.comhttps://rss.buzzsprout.com/1974774.rsspodcastindex.org
Real Food StoriesHeather Carey, MS161October 27, 2026Every two weeksbuzzsprout.com/1937869https://rss.buzzsprout.com/1937869.rsspodcastindex.org
Reversing Hashimoto's - Heal The ThyroidAnshul Gupta MD161October 29, 2026Every two weeksanshulguptamd.com/podcasthttps://rss.buzzsprout.com/2018176.rsspodcastindex.org
Recover To Flourish | Eating Disorder Recovery PodcastCiandra Birnbaum161October 20, 2026Every two weeksflourishwithciandra.comhttps://rss.buzzsprout.com/2024100.rsspodcastindex.org
Your Life Nutrition PodcastBrittany Liberatore, RDN161October 26, 2026Every two weeksyour-life-nutrition.captivate.fmhttps://feeds.captivate.fm/your-life-nutrition/podcastindex.org
EIQ onlineEmma and Emilia161October 28, 2026Every two weekseiqnutrition.comhttps://anchor.fm/s/dde47568/podcast/rsspodcastindex.org
The Dr. Haley ShowMichael Haley160October 27, 2026Every two weeksdrhaley.comhttps://feeds.captivate.fm/drhaleyshow/podcastindex.org
Dietitians in Nutrition Support: DNS PodcastHosted by Christina Rollins, RDN160October 26, 2026Every two weeksdnsdpg.orghttps://anchor.fm/s/9e4ec778/podcast/rsspodcastindex.org
PerformWell PodcastPerformWell Podcast160October 25, 2026Every two weeksteamj5.podbean.comhttps://rss2.flightcast.com/gkjskugvs6s5qnluj3sr7bka.xmlpodcastindex.org
Weight Loss Made SimpleDr. Stacy Heimburger159October 29, 2026Weeklysugarfreemd.comhttps://rss.buzzsprout.com/2259978.rsspodcastindex.org
Spot On!Dr. Joan Salge Blake158October 22, 2026Monthlyblogs.bu.edu/salgehttps://anchor.fm/s/7a93718/podcast/rsspodcastindex.org
Rewire Your Weight with Rachel FoyRewire Your Weight158October 23, 2026Monthlyrewireyourweightmethod.comhttps://feeds.captivate.fm/rewire-your-weight/podcastindex.org
Baby Steps Nutrition PodcastArgavan Nilforoush, RDN158October 15, 2026Every two weeksbaby-steps-nutrition-podcast.simplecast.comhttps://feeds.simplecast.com/tpjJ2Kblpodcastindex.org
The Self-Centered Woman PodcastRachel Hart158October 25, 2026Every two weeksreconnectedtolife.comhttps://rss.buzzsprout.com/2162214.rsspodcastindex.org
Year of Plenty: Traditional FoodwaysPoldi Wieland157September 10, 2026Monthlytheyearofplenty.comhttps://rss.buzzsprout.com/143116.rsspodcastindex.org
אוכלים את הראש - כל מה שבוער בתחום התזונהatid157October 20, 2026Every two weeksatid.podbean.comhttps://feed.podbean.com/atid/feed.xmlpodcastindex.org
Your GLP-1 BestieGianna Beasley157October 26, 2026Every two weeksyourglp1bestie.buzzsprout.comhttps://rss.buzzsprout.com/2181241.rsspodcastindex.org
WELLPOWER: Breath, Cold & BiohackingKristin Weitzel156September 24, 2026Every two weekswellpower.life/wellpower-podcasthttps://feeds.captivate.fm/wellpower-breath-cold/podcastindex.org
The Tandem Talk Showtandemnutrition156October 22, 2026Every two weekstandemnutrition.podbean.comhttps://feed.podbean.com/tandemnutrition/feed.xmlpodcastindex.org
A Little Bit Healthier | Hormone Balance, Brain Fog, Fatigue, Inflammation, Gut Health, Menopause & Weight Loss Resistance SolutionsDr. Meg Mill| Functional Medicine for Women's Health, Hormones & Gut Healing156October 20, 2026Every two weekssites.libsyn.com/413174https://feeds.libsyn.com/413174/rsspodcastindex.org
The Wellness WomanChantal - Live Lean Health / Cycles Wellness156October 22, 2026Every two weekswellnesswoman.simplecast.comhttps://feeds.simplecast.com/oDrrEN9Rpodcastindex.org
Over 50 - Lean, Strong, Powerful!Karen McCoy156October 29, 2026Every two weekswarriorwomanfitness.comhttps://rss.buzzsprout.com/2144669.rsspodcastindex.org
The Natural ListJessica Rubino and Adrienne Smith155October 28, 2026Every two weeksthe-natural-list.captivate.fmhttps://feeds.captivate.fm/the-natural-list/podcastindex.org
In ModerationRob Lapham, Liam Layton155October 29, 2026Weeklypatreon.com/InModerationPodcasthttps://rss.buzzsprout.com/2230836.rsspodcastindex.org
Aligned to Rise PodcastAlyssa Chavez155October 28, 2026Weeklybuzzsprout.com/2232799https://rss.buzzsprout.com/2232799.rsspodcastindex.org
The Sober ScoopIndia Gants155October 27, 2026Weeklypodcasters.spotify.com/pod/show/india-gants1https://rss.buzzsprout.com/2527016.rsspodcastindex.org
Functionally AutoimmuneBrandi Muilenburg154September 18, 2026Monthlyfeeds.buzzsprout.com/455935.rsshttps://rss.buzzsprout.com/455935.rsspodcastindex.org
Fork U with Dr. Terry SimpsonTerry Simpson154October 29, 2026Every two weeksforku.comhttps://feeds.captivate.fm/forku/podcastindex.org
Protein Production Technology PodcastFPG Media154October 28, 2026Every two weeksfutureofproteinproduction.comhttps://feeds.transistor.fm/the-future-of-protein-productionpodcastindex.org
Maximizing Hormones, Physique & Running Through PerimenopauseLouise Valentine154October 29, 2026Weeklybuzzsprout.com/2277005https://rss.buzzsprout.com/2277005.rsspodcastindex.org
Modern Body Modern LifeCourtney Gray154October 27, 2026Weeklycourtneygraycoaching.comhttps://rss.buzzsprout.com/2284282.rsspodcastindex.org
The Eat for Endurance PodcastClaire Shorenstein, MS RD CSSD153October 22, 2026Monthlyeatforendurance.com/eatforendurancepodcasthttps://rss.buzzsprout.com/325751.rsspodcastindex.org
The Holistic Goddess PodcastHannah Greig153October 26, 2026Every two weeksnaturallywellbyhannah.comhttps://anchor.fm/s/d939be24/podcast/rsspodcastindex.org
The Primal ShiftMK Media Group153September 11, 2026Weeklyprimalshiftpodcast.comhttps://feeds.libsyn.com/479832/rsspodcastindex.org
The Healthy, Real Food®️ Podcast with Erin Hart, BSN, RNErin Hart152October 26, 2026Weeklyerinharthealthcoaching.buzzsprout.comhttps://podcasts.helloaudio.fm/podcast/0e0026ad-a52b-49d0-a4be-43e9573cfac1/WFhSQ0dr6cpodcastindex.org
Sunshine Café: Stories to Encourage & InspireLisa Roers152October 31, 2026Weeklylisaroers.com/podcasts/sunshine-cafe-stories-to-encourage-inspirehttps://app.kajabi.com/podcasts/2147677264/feedpodcastindex.org
Breaking Up With Binge EatingGeorgie Fear151August 17, 2026Monthlyconfidenteaters.comhttps://feeds.transistor.fm/breaking-up-with-binge-eatingpodcastindex.org

Next 500 shows

Related lists

Updated November 3, 2026. Read from Podcast Index. Free for any use (the Podcast Index public database). Episode counts and dates are as each show's feed reports them to the Podcast Index. How often a show publishes is the average gap between its first and its latest episode. The index keeps at most 1,000 episodes of a show. Owner names are printed as the feed prints them. Contact addresses are not shown here. Free to reuse with credit to SpecStream under CC BY 4.0. Spot a wrong value? Write to [email protected] with the link to this page.