Skip to the page
Get started free

Data / Podcasts / Health / English

Health podcasts in English: 28,624 active shows (2026), page 9

28,624 health podcasts in English published an episode in the last 90 days to October 31, 2026. 9,950 publish at least weekly and 7,177 published in the last 7 days. The list gives each show's owner, episode count, last episode, publishing frequency, website and feed, read from the Podcast Index on November 3, 2026.

SpecStream is the live web data engine for teams and agents. It reads the Podcast Index every day, and this page is that reading. Ask for the shows you want by topic, language and how often they publish, with each show's contact, and new and changed shows arrive in your sheet, CRM, Slack or agent.

Get health podcasts in EnglishWatch for new shows

Active health podcasts in English, 4,001 to 4,500

ShowOwnerEpisodesLast episodePublishesWebsiteFeedSource
No More Religion: I Choose Much MoreHarold J Perkins229October 26, 2026Weeklynomorereligion.buzzsprout.comhttps://rss.buzzsprout.com/1998506.rsspodcastindex.org
Homeopathy 247 PodcastMary Greensmith229October 29, 2026Weeklysites.libsyn.com/419117https://feeds.libsyn.com/419117/rsspodcastindex.org
MindWellthChelsea229October 28, 2026Weeklymind-wellth.comhttps://rss.buzzsprout.com/2007123.rsspodcastindex.org
Sleep Unplugged with Dr. Chris WinterChris Winter, MD229October 26, 2026Weeklysleepunplugged.comhttps://rss.buzzsprout.com/2010257.rsspodcastindex.org
The Habit Thrive Podcast ~ Self Care Habits, Mindfulness & Wellness Routines for Women 50 & Beyondactiveoptionsbylorrie229October 31, 2026Weeklylorriemickelson.comhttps://podcasts.helloaudio.fm/podcast/31b8396b-7339-47a5-93a3-f9aefd7e8c5a/idCpX3rcg1podcastindex.org
Trying Not to CareAshley Corbo229October 26, 2026Weeklyinstagram.com/tryingnottocarepodcasthttps://audioboom.com/channels/5085605.rsspodcastindex.org
RhAPPcastRheumatology Advanced Practice Providers (RhAPP)229October 31, 2026Weeklyrhappcast.captivate.fmhttps://feeds.captivate.fm/rhappcast/podcastindex.org
Why So Serious with Elizabeth & DanielElizabeth Jordan229October 29, 2026Several times a weekempoweringmendaily.wordpress.comhttps://www.spreaker.com/show/6686754/episodes/feedpodcastindex.org
𝐃𝐚𝐢𝐥𝐲 𝐢𝐧𝐬𝐩𝐢𝐫𝐚𝐭𝐢𝐨𝐧 𝐁𝐲 𝐢𝐧𝐬𝐩𝐢𝐫𝐞𝐝𝐁𝐲𝐅𝐥𝐨𝐫𝐢𝐚𝐧𝐢𝐧𝐬𝐩𝐢𝐫𝐞𝐝𝐁𝐲𝐅𝐥𝐨𝐫𝐢𝐚𝐧229October 27, 2026Several times a weekshows.acast.com/inspiredbyflorianpodcastindex.org
HINESIGHTS PodcastHinesights229October 24, 2026Every two weeksspreaker.com/podcast/hinesights-podcast--7378697https://www.spreaker.com/show/7378697/episodes/feedpodcastindex.org
The Plant Path: Clinical Herbalism, Medical Astrology & Spagyric AlchemySajah Popham228October 28, 2026Every two weeksevolutionaryherbalism.comhttps://theplantpath.libsyn.com/rsspodcastindex.org
God + Mental Health PodcastRoslyn Rene228October 29, 2026Every two weeksredcircle.com/shows/therapy-as-a-christianhttps://feeds.redcircle.com/2dc54a8c-9316-4e45-b38c-031af4c08779podcastindex.org
LIFE.STYLE.LIVE!All INdiana Podcast Network228September 29, 2026Every two weekswishtv.com/podcasts/life-style-live-podcasthttps://rss.art19.com/life-style-live-podcastpodcastindex.org
Keeping it Real with Nyree and FionaNyree Segui and Fiona Alford228October 27, 2026Every two weeksanchor.fm/nyree73https://rss.buzzsprout.com/1801537.rsspodcastindex.org
Dear Nina: Conversations About FriendshipNina Badzin228October 27, 2026Every two weeksredcircle.com/shows/dear-nina-conversations-about-friendshiphttps://feeds.redcircle.com/57b18245-8acf-49dd-a445-dd62f83e7d9cpodcastindex.org
The Dental HandoffDr. Kelly Tanner228October 27, 2026Weeklythedentalhandoff.podbean.comhttps://feed.podbean.com/thedentalhandoff/feed.xmlpodcastindex.org
The Still Space PodcastMary Lee Gannon228October 29, 2026Weeklymaryleegannon.com/podcasts/the-still-space-podcasthttps://app.kajabi.com/podcasts/2147503781/feedpodcastindex.org
Strong Is a MindsetCarrie Holland228October 28, 2026Weeklycarriehollandmd.comhttps://feeds.libsyn.com/419126/rsspodcastindex.org
Weight What?Leah Yax, Kamna Jain228October 27, 2026Weeklyhealthcoachkamna.comhttps://anchor.fm/s/aae2e76c/podcast/rsspodcastindex.org
Well Beyond Medicine: The Nemours Children's Health PodcastNemours Children's Health228October 26, 2026Weeklynemourswellbeyond.orghttps://rss.buzzsprout.com/2170925.rsspodcastindex.org
The Relationship PlaybookChaz Douglas228October 30, 2026Weeklyin-my-humble-opinion-wi.captivate.fmhttps://feeds.captivate.fm/in-my-humble-opinion-wi/podcastindex.org
Sleepy Stories: To help you sleepSleepy Studios228October 30, 2026Weeklyspreaker.com/show/sleepy-stories-to-help-you-sleephttps://www.spreaker.com/show/5818206/episodes/feedpodcastindex.org
Gina Carla Fans ClubAbid228October 17, 2026Several times a weekyoutube.com/@asmrwithginahttps://anchor.fm/s/1038298a4/podcast/rsspodcastindex.org
Romance at a GlanceRomance at a Glance227October 31, 2026Every two weeksromanceataglance.comhttps://feeds.captivate.fm/romance-at-a-glance/podcastindex.org
Women's Running StoriesCherie Louise Turner227September 29, 2026Every two weekswomensrunningstories.comhttps://feeds.simplecast.com/Akz093_Tpodcastindex.org
Brands for a Better World (formerly Evolve CPG)Gage Mitchell of Modern Species227August 27, 2026Every two weeksart19.com/shows/brands-for-a-better-worldhttps://rss.art19.com/brands-for-a-better-worldpodcastindex.org
Primary Care PerspectivesChildren’s Hospital of Philadelphia227October 19, 2026Monthlymarketingn4.podbean.comhttps://feed.podbean.com/marketingn4/feed.xmlpodcastindex.org
IVF ThisEmily Ginn227October 26, 2026Every two weeksivfthispodcast.libsyn.comhttps://ivfthispodcast.libsyn.com/rsspodcastindex.org
FOF Gym ChatKenzie and Josh Presnell227October 9, 2026Every two weeksfixedonfitness.comhttps://anchor.fm/s/2f79d9f0/podcast/rsspodcastindex.org
Two Girls One Ship: Reviewing Video Game RomancesJennasis and Virvada227October 26, 2026Every two weekslinktr.ee/twogirlsoneshiphttps://feeds.megaphone.fm/twogirlsoneshippodcastindex.org
Digital Health Talks - Changemakers Focused on Fixing HealthcarePurpose Events, LLC227October 21, 2026Every two weeksdigitalhealthtalks.comhttps://feeds.simplecast.com/1PnzHzVTpodcastindex.org
Catch Ups In My KitchenGeorgia Symonds227October 27, 2026Weeklybuzzsprout.com/1928307podcastindex.org
Blended, Blessed & Always A MessAric & Angie227October 18, 2026Weeklyblendedblessedalwaysamess.comhttps://rss.buzzsprout.com/1951710.rsspodcastindex.org
Trail EAffectJosh Blum227October 13, 2026Weeklytraileaffectpodcast.comhttps://traileaffect.podbean.com/feed.xmlpodcastindex.org
My Coach KateKate Bixler227October 27, 2026Weeklybuzzsprout.com/2010756https://rss.buzzsprout.com/2010756.rsspodcastindex.org
Brave Widow ShowEmily Tanner227October 27, 2026Weeklybravewidow.com/podcasts/brave-widow-showhttps://app.kajabi.com/podcasts/2147507883/feedpodcastindex.org
The Nero ShowChris Miller227October 29, 2026Weeklypodserve.fm/series/website/the-nero-cycling-show-unfiltered-cycling-podcast,6100podcastindex.org
Trail EAffectJosh Blum227October 13, 2026Weeklytraileaffectpodcast.comhttps://feed.podbean.com/traileaffect/feed.xmlpodcastindex.org
The Binu ShowBinu Dhindsa227October 27, 2026Weeklybinu.cahttps://anchor.fm/s/e8e1cd6c/podcast/rsspodcastindex.org
AMC Clinical Deep DiveMedistanding227October 26, 2026Several times a weekpodcasters.spotify.com/pod/show/jasper0627https://anchor.fm/s/104c77e78/podcast/rsspodcastindex.org
Curiouser + Curiouser Daily PodcastHeather aka Nookie227October 30, 2026Several times a weekrss.com/podcasts/curiouser-and-curiouserhttps://media.rss.com/curiouser-and-curiouser/feed.xmlpodcastindex.org
The Third House Astrology and WellnessErica Barnes227October 30, 2026Weeklythethirdhouse.orghttps://anchor.fm/s/e8e27a14/podcast/rsspodcastindex.org
Julia Kristina CounsellingJulia Kristina Counselling227October 31, 2026Dailyspreaker.com/podcast/julia-kristina-counselling--7358058https://www.spreaker.com/show/7358058/episodes/feedpodcastindex.org
Arthritis LifeCheryl Crow226October 22, 2026Every two weeksarthritis-life-podcast.simplecast.comhttps://feeds.simplecast.com/G6vQ_rtFpodcastindex.org
Psoriasis UncoveredNational Psoriasis Foundation226October 27, 2026Every two weekspsoundbytes.npf.libsynpro.com/websitehttps://psoundbytes.libsyn.com/rsspodcastindex.org
The Hormone Genius PodcastThe Hormone Genius Podcast226October 28, 2026Every two weekshormonegenius.comhttps://feeds.soundcloud.com/users/soundcloud:users:865565875/sounds.rsspodcastindex.org
Texas Tech Health CheckTexas Tech University Health Sciences Center226October 27, 2026Every two weeksttuhsc.edu/communications-marketing/media/podcast/default.aspxhttps://rss.buzzsprout.com/606544.rsspodcastindex.org
Your Health. Your Story.Innovative Medicine226October 22, 2026Every two weeksinnovativemedicine.comhttps://rss.buzzsprout.com/678623.rsspodcastindex.org
The James Granstrom Podcast - Super Soul Model seriesJames Granstrom226October 29, 2026Every two weeksjamesgranstrom.comhttps://rss.buzzsprout.com/678061.rsspodcastindex.org
The Paul's Body Engineering PodcastPaul's Body Engineering Podcast226September 15, 2026Every two weekspaulsbodyengineering.comhttps://feeds.soundcloud.com/users/soundcloud:users:852086884/sounds.rsspodcastindex.org
Palm Harbor LocalDonnie Hathaway226October 22, 2026Every two weekspalmharborlocal.comhttps://rss.buzzsprout.com/1445077.rsspodcastindex.org
Talk My CredoDonte Credo226October 20, 2026Every two weeksredcircle.com/shows/talkmycredohttps://feeds.redcircle.com/0f3da812-65c2-4be7-8f38-fceda3793459podcastindex.org
AMA STEPS Forward® podcastAmerican Medical Association226October 28, 2026Every two weeksedhub.ama-assn.org/steps-forward/pages/podcasthttps://feeds.simplecast.com/2tSAHdU6podcastindex.org
Jacked Girl UniversityAimee Bartolo226October 29, 2026Every two weeksthefemalephysiquehub.mykajabi.com/podcasts/jacked-girl-universityhttps://app.kajabi.com/podcasts/2147487944/feedpodcastindex.org
Talk the WalkP73226October 26, 2026Weeklytalkthewalk.podbean.comhttps://talkthewalk.podbean.com/feed.xmlpodcastindex.org
Talk the WalkP73226October 26, 2026Weeklytalkthewalk.podbean.comhttps://feed.podbean.com/talkthewalk/feed.xmlpodcastindex.org
Talking NutritionJohan Vesters226October 26, 2026Weeklyodysseycoachingsystems.cohttps://rss.buzzsprout.com/2017698.rsspodcastindex.org
Voodoo PowerSteven226October 30, 2026Weeklyvoodoo4ranch.comhttps://rss.buzzsprout.com/2041168.rsspodcastindex.org
Integrative Lyme Solutions with Dr. KarlfeldtDr. Michael Karlfeldt226October 26, 2026Every two weeksintegrative-lyme-solutions-with-dr-karlfeldt.castos.comhttps://feeds.transistor.fm/integrative-lyme-solutions-with-dr-karlfeldtpodcastindex.org
Nacho Fitness CoachCaleigh and Sara226October 28, 2026Weeklynachofitnesscoach.comhttps://media.rss.com/nachofitnesscoach/feed.xmlpodcastindex.org
Supernormalized PodcastSupernormalized Podcast226October 13, 2026Weeklysupernormalized.comhttps://feeds.castos.com/r4n40podcastindex.org
Park StoriesPRB+ Magazine226October 30, 2026Weeklyparksandrecbusiness.comhttps://rss.buzzsprout.com/2175220.rsspodcastindex.org
NewsRamp Cannabis PodcastAttentionWorthy Inc.226August 19, 2026Weeklynewsramp.com/podcasts/cannabishttps://feeds.newsramp.net/podcast/cannabis.rsspodcastindex.org
Dr. Kara Fitzgerald | New Frontiers in Functional Medicine, Longevity, EpigeneticsDr. Kara Fitzgerald - Functional Med & Longevity226October 22, 2026Monthlydrkarafitzgerald.comhttps://feeds.captivate.fm/dr-kara-fitzgerald/podcastindex.org
About IBDAbout IBD With Amber J Tresca225October 20, 2026Every two weeksaboutibd.comhttps://aboutibd.libsyn.com/rsspodcastindex.org
HYDRATE with Tracy DuhsTracy Duhs225October 28, 2026Every two weekstracyduhs.comhttps://anchor.fm/s/105df6fb4/podcast/rsspodcastindex.org
Australian Prescriber PodcastAustralian Prescriber225October 19, 2026Every two weeksaustralianprescriber.tg.org.au/podcast.htmlhttps://australianprescriber.libsyn.com/rsspodcastindex.org
Dr. Marcia Sirota MD hosts Ruthless CompassionDr. Marcia Sirota MD225October 15, 2026Monthlymarciasirotamd.comhttps://feed.pod.co/ruthless-compassion-with-dr-marcia-sirotapodcastindex.org
Unbox The PodcastSahar Huneidi Palmer225October 7, 2026Monthlysites.libsyn.com/27201/sitehttps://rss.pdrl.fm/2f8bc7/feeds.libsyn.com/27201/rss/?redirect=falsepodcastindex.org
The PulseWHYY225October 29, 2026Every two weekswhyy.org/programs/the-pulsehttps://publicfeeds.net/f/12369/thepulse.xmlpodcastindex.org
OCD Straight TalkChris Leins, MA, NCC, LPCC-S225October 30, 2026Every two weeksthetenthousandlakes.comhttps://anchor.fm/s/16096f6c/podcast/rsspodcastindex.org
MSSNY PodcastsMSSNY225October 8, 2026Monthlymssny.orghttps://rss.buzzsprout.com/51522.rsspodcastindex.org
The Beyond Built PodcastBeyond Built225October 29, 2026Every two weeksbeyondbuilttraining.comhttps://beyondbuilt.libsyn.com/rsspodcastindex.org
Relaxations, Breathwork, & Meditations by Yoga for SclerodermaAlexis Harrison, Pat McMillan, Kathy Randolph225October 22, 2026Every two weeksyogaforscleroderma.comhttps://rss.buzzsprout.com/1314106.rsspodcastindex.org
Medicine RedefinedAltamash Raja, DO and Darsh Shah, DO225October 19, 2026Every two weeksmedicineredefined.comhttps://rss2.flightcast.com/mwbb2hkr7rk5ya3169idhwnc.xmlpodcastindex.org
Journey to GratefulTim Bigonia225October 27, 2026Every two weeksjourneytograteful.comhttps://feeds.captivate.fm/journey-to-grateful/podcastindex.org
Finding Freedom with Jemma RoseJemma Haythorne225October 28, 2026Every two weeksinspirewellnessau.com.auhttps://rss.buzzsprout.com/1860871.rsspodcastindex.org
This Daring AdventureTrista Guertin225October 29, 2026Weeklytristaguertin.comhttps://feeds.captivate.fm/this-daring-adventure/podcastindex.org
Spirit SpeakeasyJoy Giovanni225October 30, 2026Weeklyjoyfulmedium.comhttps://rss.buzzsprout.com/2084888.rsspodcastindex.org
Buddies For LifeSolid Gold Podcasts #BeHeard225October 1, 2026Weeklybuddiesforlife.co.zahttps://iono.fm/rss/chan/7718podcastindex.org
Soulful Sharing CircleTara Stricker- TSW225October 11, 2026Every two weekstaratsw.substack.com/podcastpodcastindex.org
Smart Injury Doctors PodcastDr. Jeffrey Alan Cronk224August 16, 2026Every two weekssmartinjurydoctor.comhttps://feeds.transistor.fm/smart-injury-doctors-podcastpodcastindex.org
Noggin Notes PodcastJake Wiskerchen224October 31, 2026Every two weeksnogginnotespod.podbean.comhttps://nogginnotespod.podbean.com/feed.xmlpodcastindex.org
Bikes or DeathPatrick Farnsworth224September 15, 2026Every two weeksbikesordeath.comhttps://bikesordeath.libsyn.com/rsspodcastindex.org
Butts & Guts: A Cleveland Clinic Digestive Health PodcastCleveland Clinic Digestive Disease & Surgery Institute224October 27, 2026Every two weeksmy.clevelandclinic.org/departments/digestivehttps://rss.buzzsprout.com/2246824.rsspodcastindex.org
Root Cause Revolution PodcastAudrey Christie, ND-trad, MSN, RN224October 30, 2026Every two weeksaudreychristie.com/bloghttps://rss.buzzsprout.com/1535428.rsspodcastindex.org
Bendy Bodies with Dr. Linda BluesteinDr. Linda Bluestein224October 29, 2026Every two weeksbendybodiespodcast.comhttps://feeds.megaphone.fm/bendybodiespodcastindex.org
THRIVING IN TIMES OF STRUGGLEMichael C. Patterson224August 28, 2026Every two weeksmindramp.orghttps://rss.buzzsprout.com/777224.rsspodcastindex.org
People Who Read People: A Behavior and Psychology PodcastZachary Elwood224October 17, 2026Every two weeksbleav.com/shows/people-who-read-people-a-behavior-and-psychology-podcasthttps://feeds.simplecast.com/CvnIV2jLpodcastindex.org
Connect Inspire CreateCarol Clegg224October 27, 2026Every two weekscarolclegg.comhttps://rss.buzzsprout.com/1392172.rsspodcastindex.org
Well2You PodcastSue McCarroll224October 20, 2026Every two weekswell2you.org/w2ypodcasthttps://rss.buzzsprout.com/1585855.rsspodcastindex.org
NECA in the KnowNECA AETC224October 29, 2026Every two weeksnecaintheknow.buzzsprout.comhttps://rss.buzzsprout.com/1272989.rsspodcastindex.org
CURE SYNGAP1 PODCAST aka SYNGAP10Syngap Research Fund, 501(c)(3)224October 26, 2026Every two weekssyngap10.podbean.comhttps://feed.podbean.com/syngap10/feed.xmlpodcastindex.org
The Hotflash inc podcastHotflash inc224October 29, 2026Every two weeksapi.riverside.fm/hosting/8jHhQVGp.rsshttps://api.riverside.fm/hosting/8jHhQVGp.rsspodcastindex.org
Tend HER Wild PodcastDr. Betsy Rippentrop and Kate Moreland224October 31, 2026Weeklytendherwild.comhttps://www.tendherwild.com/feed/podcast/podcastindex.org
You’re Not for EveryoneJackie Henderson224October 12, 2026Weeklysafesoulcenter.orghttps://rss.buzzsprout.com/1987585.rsspodcastindex.org
eanCast: Weekly Neurologyean.org224October 25, 2026Weeklyeancast.podigee.iohttps://eancast.podigee.io/feed/mp3podcastindex.org
BFF: Black, Fat, FemmeiHeartPodcasts224October 27, 2026Weeklyiheart.com/podcast/1119-bff-black-fat-femme-98632371https://www.omnycontent.com/d/playlist/e73c998e-6e60-432f-8610-ae210140c5b1/8cdb2d74-0100-4c0a-b270-aebb00fb5996/2e44cd03-b059-4c78-98dc-aebb00fbdcfd/podcast.rsspodcastindex.org
Wild & WakingEmily Reuschel224October 29, 2026Weeklyemilyreuschel.comhttps://feeds.captivate.fm/wild-and-waking/podcastindex.org
Live Unrestricted - The Intuitive Eating & Food Freedom PodcastSabrina Magnan224October 28, 2026Weeklyliveunrestrictedpodcast.buzzsprout.comhttps://rss.buzzsprout.com/2062269.rsspodcastindex.org
Cameron Hanes - Keep Hammering CollectiveCameron Hanes224October 23, 2026Weeklysites.libsyn.com/455868https://feeds.megaphone.fm/KHC3864819137podcastindex.org
The Rewrite...A Podcast about Divorce, Choice & New BeginningsWhat's Up with Wendy224October 27, 2026Weeklyinstagram.com/therewrite_podcasthttps://www.spreaker.com/show/5507039/episodes/feedpodcastindex.org
Pushing Up LiliesJulie Mattson224October 28, 2026Weeklypushing-up-lilies.simplecast.comhttps://feeds.simplecast.com/_dK05UMEpodcastindex.org
Creating a buzz about health with Paula CarnellPaula Carnell224October 26, 2026Weeklypaulacarnell.compodcastindex.org
A GLP-1 Guide to Metabolic Health: The Plus SideZ PodcastKim Carlos224October 27, 2026Weeklytheplussidez.comhttps://rss.buzzsprout.com/2167931.rsspodcastindex.org
Your Friend in the HeadHenny Moody224October 29, 2026Weeklyig.me/m/henny_moodypodcastindex.org
Tom The Trainer's Fitness Over 40Tom Mouland224October 22, 2026Weeklyshows.acast.com/6514b277936e07001165005epodcastindex.org
The Assisted Living Investing PodcastBrandon Gustafson224October 23, 2026Weeklyassistedlivinginvesting.net/podcasts/the-assisted-living-investing-podcasthttps://app.kajabi.com/podcasts/2147757640/feedpodcastindex.org
Spiritual Fitness with Eric BiggerBig Pond Podcasts223October 28, 2026Every two weeksbiggertalks.libsyn.com/websitehttps://feeds.zencastr.com/f/2FzvIy0i.rsspodcastindex.org
Beauty and the SurgeonMagelssen Media223October 15, 2026Every two weeksbeautyandthesurgeonpodcast.comhttps://beautyandthesurgeon.libsyn.com/rsspodcastindex.org
Mainly Plants PodcastRyan Furman223October 22, 2026Monthlymainlyplants.comhttp://feeds.feedburner.com/mainlyplants/yAOcpodcastindex.org
Gay Therapy LA with Ken Howard, LCSWKen Howard, LCSW223October 19, 2026Every two weeksgaytherapyla.libsyn.com/websitehttps://gaytherapyla.libsyn.com/rsspodcastindex.org
The Divine Feminine Healer's PodcastAngelica Neri223October 30, 2026Every two weeksart19.com/shows/the-divine-feminine-healershttps://app.kajabi.com/podcasts/2147497590/feedpodcastindex.org
Deep into SleepYishan Xu, PhD, DBSM223October 13, 2026Every two weeksdeepintosleep.cohttps://feeds.captivate.fm/deep-into-sleep/podcastindex.org
At The CCC | A Queer Recovery PodcastThe Castro Country Club223October 26, 2026Every two weeksattheccc.buzzsprout.comhttps://rss.buzzsprout.com/1749750.rsspodcastindex.org
Recovery Matters! PodcastCCAR223October 20, 2026Every two weeksccar.ushttps://feeds.simplecast.com/sV0XD3iYpodcastindex.org
The ATA Nation PodcastZach Hayden223October 26, 2026Every two weeksthe-ata-nation-podcast.castos.comhttps://feeds.captivate.fm/atanationpodcast/podcastindex.org
Frequency Specific Microcurrent PodcastDr. Carolyn McMakin223September 30, 2026Every two weeksfrequencyspecific.comhttps://frequencyspecific.libsyn.com/rsspodcastindex.org
The Autism Mom CoachLisa Candera223October 28, 2026Weeklytheautismmomcoach.comhttps://feeds.captivate.fm/be-the-solid-object/podcastindex.org
Mental Obsession Discussion / Emotional Sobriety / Spiritual Malady- We Know Jack.223October 23, 2026Every two weeksmentalobsessiondiscussion.buzzsprout.comhttps://rss.buzzsprout.com/1889762.rsspodcastindex.org
Mind Your Own Karma - Beyond The BandageMelissa Brunetti223October 20, 2026Every two weeksmindyourownkarma.comhttps://anchor.fm/s/70b758c0/podcast/rsspodcastindex.org
LIFE Beyond AphasiaLIFE Aphasia Academy® Genevieve Richardson223October 29, 2026Weeklylistenforlifepodcast.comhttps://feed.podbean.com/lifebeyondaphasia/feed.xmlpodcastindex.org
Just the WHO of usReah H223October 31, 2026Weeklyfalolity.podbean.comhttps://falolity.podbean.com/feed.xmlpodcastindex.org
Just the WHO of usReah H223October 31, 2026Weeklyfalolity.podbean.comhttps://feed.podbean.com/Falolity/feed.xmlpodcastindex.org
Lighthouse Church Fargo PodcastsLighthouse Church223October 25, 2026Weeklylhcfargo.orghttps://media.rss.com/happyhourlhc/feed.xmlpodcastindex.org
Simple Fitness Habits | Workout Plans, Health Habits, Functional Movement, Holistic Health, Home DetoxShaela Daugherty | Personal Trainer, Christian Fitness Coach, Christian Nutrition, Homeschool Mom223October 26, 2026Weeklythestrongerco.com/podcasts/simple-fitness-habits-workout-plans-health-habits-funhttps://app.kajabi.com/podcasts/2147507592/feedpodcastindex.org
Seasons of JoyJill Pack223October 27, 2026Weeklyseasonsofjoy.podbean.comhttps://feed.podbean.com/seasonsofjoy/feed.xmlpodcastindex.org
Fitness + TechnologyBryan O'Rourke222October 26, 2026Monthlyfitnesstech.libsyn.com/podcasthttps://fitnesstech.libsyn.com/rsspodcastindex.org
Dermasphere - The Dermatology PodcastLuke Johnson222October 26, 2026Every two weeksdermaspherepodcast.comhttps://anchor.fm/s/866b34c/podcast/rsspodcastindex.org
Kinky Frame of MindDon Juan222October 20, 2026Every two weekskinky-frame-of-mind.simplecast.comhttps://feeds.simplecast.com/JEkfyAHGpodcastindex.org
SeamossgirliesiHeartPodcasts222October 28, 2026Every two weeksinstagram.com/seamossgirlieshttps://www.omnycontent.com/d/playlist/e73c998e-6e60-432f-8610-ae210140c5b1/8feb1906-956f-4a94-b4ee-b3b1015f4464/35551d09-01b8-4a8d-8461-b3b1015f449c/podcast.rsspodcastindex.org
Urology Times PodcastsUrology Times222September 23, 2026Every two weeksurologytimes.comhttps://audioboom.com/channels/5027208.rsspodcastindex.org
First Responder Wellness Podcast with Conrad WeaverConrad Weaver222October 28, 2026Every two weeksfirstresponderfriday.podbean.comhttps://feed.podbean.com/firstresponderfriday/feed.xmlpodcastindex.org
Path to Peace with Todd PerelmuterTodd Perelmuter222October 24, 2026Every two weekseastwesticism.orghttps://rss.buzzsprout.com/1590046.rsspodcastindex.org
Not Allowed to DieDaniel J Maigler222October 21, 2026Every two weekspodcasters.spotify.com/pod/show/daniel-j-maiglerhttps://anchor.fm/s/611325c0/podcast/rsspodcastindex.org
Canicross ConversationsMichelle Mortimer and Louise Humphrey222October 30, 2026Every two weekscanicrossconversations.co.ukhttps://feed.podbean.com/canicrossconversations/feed.xmlpodcastindex.org
The Happy Moments पल पल की खुशियाँSanjay Rajpal222October 29, 2026Every two weeksthe-happy-moments.captivate.fmhttps://feeds.captivate.fm/the-happy-moments/podcastindex.org
Rock That Fitness with AnnaRockstarAnna Wilson222October 26, 2026Weeklyrockthatfitness.comhttps://anchor.fm/s/7ed99968/podcast/rsspodcastindex.org
Doc Talk with Monument HealthMonument Health222October 27, 2026Weeklyshows.acast.com/doc-talk-with-monument-healthpodcastindex.org
There She Glows with Becca NichollsBecca Nicholls222October 29, 2026Weeklybuzzsprout.com/2038518https://rss.buzzsprout.com/2038518.rsspodcastindex.org
Venus & Vesta Evolutionary AstrologyAnn-Louise Holland222October 30, 2026Weeklyvenusandvesta.comhttps://feeds.captivate.fm/venus-vesta/podcastindex.org
So Far So Good Coaching PodcastValerie Busse222October 27, 2026Weeklypodcasters.spotify.com/pod/show/valerie-bussehttps://anchor.fm/s/b0569c98/podcast/rsspodcastindex.org
The Live Healthy With Laura PodcastLaura Heflin222October 26, 2026Weeklyspotifyanchor-web.app.link/e/bWAhKxL5Gubhttps://anchor.fm/s/4cb3567c/podcast/rsspodcastindex.org
Funny Till It's NotJoshua Albanese222October 28, 2026Weeklyredcircle.com/shows/funny-till-its-nothttps://feeds.redcircle.com/a4338fbf-0b92-49f3-b803-60cee64b9942podcastindex.org
Disrupting ObesityCharlotte Skanes222October 21, 2026Weeklydisruptingobesity.comhttps://rss.buzzsprout.com/2237789.rsspodcastindex.org
Manders MindsetAmanda Russo222October 5, 2026Weeklymandersmindset.buzzsprout.comhttps://rss.buzzsprout.com/2233710.rsspodcastindex.org
Unstuck with Jay AbbasiJay Abbasi222October 30, 2026Weeklyjayabbasi.mehttps://feeds.megaphone.fm/unstuckpodcastindex.org
Unstuck with Jay AbbasiJay Abbasi222October 30, 2026Weeklyspreaker.com/podcast/unstuck-with-jay-abbasi--6233703https://www.spreaker.com/show/6233703/episodes/feedpodcastindex.org
Normal isn’t necessarygumballhead_official222October 14, 2026Several times a weekgumballheadkzoo.podbean.comhttps://feed.podbean.com/gumballheadkzoo/feed.xmlpodcastindex.org
Inspiration Sessions with Justin Michael WilliamsJustin Michael Williams221October 1, 2026Every two weeksmotivationforblackpeople.comhttps://feeds.simplecast.com/Ge7IP_svpodcastindex.org
A Fresh Approach ...with Sonya :)221October 14, 2026Every two weekscastbox.fm/ch/2727704http://rss.castbox.fm/everest/9d0f7fe9b5644fdfbe0850014b28136e.xmlpodcastindex.org
WOCTalkWOCN Society221October 30, 2026Every two weekswocn.org/podcasthttps://feeds.simplecast.com/P6LDJdDapodcastindex.org
European Society for Vascular SurgeryEuropean Society for Vascular Surgery221October 29, 2026Every two weeksesvs.orghttps://media.rss.com/esvs/feed.xmlpodcastindex.org
The Hippie Moms PodcastBecky Wells221September 25, 2026Every two weeksthe-hippiemoms-podcast.simplecast.comhttps://feeds.simplecast.com/qIt9_E0Fpodcastindex.org
Talk Tantra to Me with LeolaLeola221October 28, 2026Every two weeksleola.buzzsprout.comhttps://rss.buzzsprout.com/1488109.rsspodcastindex.org
Her Story UnscriptedHeather Nelson221October 29, 2026Every two weeksconnectionhive.com/podcasthttps://rss.buzzsprout.com/1761977.rsspodcastindex.org
The People First PodcastPeople First Keighley & Craven221October 28, 2026Every two weekspeoplefirstkc.com/pfkc-podcasthttps://rss.buzzsprout.com/1780748.rsspodcastindex.org
EXAMINE YOUR STORYDr. Susan Regisford/ Deaconess Susan221October 28, 2026Every two weeksbestyoumadepossible.comhttps://anchor.fm/s/65b15e30/podcast/rsspodcastindex.org
Eugene Trufkin RadioEugeny Trufkin221October 27, 2026Every two weekseugene-trufkin-radio-0959392d.simplecast.comhttps://feeds.simplecast.com/13_O9sz4podcastindex.org
The Struggle Climbing ShowRyan Devlin221October 28, 2026Weeklythestruggleclimbingshow.comhttps://feed.podbean.com/thestruggleclimbingshow/feed.xmlpodcastindex.org
In Totality with Megan AshleyMegan Ashley221October 20, 2026Weeklyart19.com/shows/in-totality-megan-ashleyhttps://rss.art19.com/in-totality-megan-ashleypodcastindex.org
The Feeling Lighter PodcastWeShape221October 28, 2026Weeklyweshape.comhttps://feeds.captivate.fm/feelinglighter/podcastindex.org
Veterinary VertexAVMA Journals221October 30, 2026Weeklyveterinaryvertex.buzzsprout.comhttps://rss.buzzsprout.com/2047448.rsspodcastindex.org
Rox Lyfe - The HYROX PodcastGreg Williams221October 29, 2026Weeklyroxlyfe.comhttps://anchor.fm/s/bde82534/podcast/rsspodcastindex.org
Cosmic Navigator Astrology ShowGahl Sasson221October 25, 2026Every two weekscosmicnavigator.compodcastindex.org
The Keri Croft ShowKeri Croft221October 29, 2026Weeklythekericroftshow.buzzsprout.comhttps://rss.buzzsprout.com/2110753.rsspodcastindex.org
Lorna Marie Fitness PodcastLorna Marie Fitness221October 29, 2026Weeklylornamariefitness.co.ukhttps://anchor.fm/s/d9449cf4/podcast/rsspodcastindex.org
Sleeping with CelebritiesMaximum Fun221October 28, 2026Weeklymaximumfun.org/podcasts/sleeping-with-celebritieshttps://feeds.simplecast.com/ebjiDp6hpodcastindex.org
Your Gym Big Sister PodcastEmma Currivan221October 30, 2026Weeklypodcasters.spotify.com/pod/show/emma-currivanhttps://anchor.fm/s/d9e8c84c/podcast/rsspodcastindex.org
HerniaTalk LIVEBeverly Hills Hernia Center221October 7, 2026Every two weeksbeverlyhillsherniacenter.comhttps://rss.buzzsprout.com/2140993.rsspodcastindex.org
The Forever Athletic PodcastIan Wood221October 26, 2026Weeklycoachianwood.comhttps://anchor.fm/s/e3d52b5c/podcast/rsspodcastindex.org
Bird’s Eye ViewMathew G. Radford221October 28, 2026Weeklybuzzsprout.com/2077275https://rss.buzzsprout.com/2077275.rsspodcastindex.org
Spicy SpectrumPepper Kat221October 28, 2026Weeklylinktr.ee/spicyspectrumpodcasthttps://rss.buzzsprout.com/2268686.rsspodcastindex.org
["It's YOUR f'ing journey!", "It's YOUR f'ing journey!"]Melissa McWeeny221October 26, 2026Weeklyit-s-your-f-ing-journey.zencast.websitehttps://rss.buzzsprout.com/2385902.rsspodcastindex.org
Motherhood Alliance PodcastMotherhood Alliance221October 26, 2026Weeklymotherhoodalliance.podbean.comhttps://api.riverside.fm/hosting/kHY1zM1n.rsspodcastindex.org
Age Better with Barbara Hannah GruffermanBarbara Hannah Grufferman221October 27, 2026Weeklybarbarahannahgrufferman.comhttps://feeds.megaphone.fm/SAS6139674544podcastindex.org
Real People Real TalkPaul Calcote220October 12, 2026Every two weeksrealpeoplerealtalk.buzzsprout.comhttps://rss.buzzsprout.com/1113380.rsspodcastindex.org
We Talk Health - Official Podcast of West Tennessee HealthcareWest Tennessee Healthcare220October 14, 2026Every two weekswth.orghttps://rss.buzzsprout.com/772148.rsspodcastindex.org
Sacred Feminine PowerEmmi Mutale, Feminine Revered220October 8, 2026Every two weeksfemininerevered.comhttps://rss.buzzsprout.com/1038388.rsspodcastindex.org
More Than One TruthAyisha Elliott220October 24, 2026Every two weeksspreaker.com/show/black-girl-from-eugenehttps://www.spreaker.com/show/6035717/episodes/feedpodcastindex.org
Betrayal Trauma RecoveryAnne Blythe, M.Ed.220October 27, 2026Weeklybtr.orghttps://feeds.podcastmirror.com/btrpodcastindex.org
Women & ADHDKaty Weber220October 19, 2026Every two weeksredcircle.com/shows/women-and-adhdhttps://feeds.redcircle.com/43b834d6-fd36-4f6d-9ecc-e0efc17e56cbpodcastindex.org
The Mental Matchup220October 28, 2026Every two weeksmorgansmessage.org/podcast-episodeshttps://www.morgansmessage.org/podcast-episodes?format=rsspodcastindex.org
Sober EdgeTeri Patterson220October 21, 2026Every two weeksthesobernutritionist.comhttps://soberedgepodcast.libsyn.com/rsspodcastindex.org
The HX Podcast with Stacie BairdStacie Baird220September 11, 2026Weeklystaciebaird.com/the-hx-podcasthttps://feeds.libsyn.com/408332/rsspodcastindex.org
Chinese Medicine MattersMayway Herbs220October 30, 2026Weeklychinesemedicinematters.comhttps://rss.buzzsprout.com/2011916.rsspodcastindex.org
With IntentionCami Sophia220October 28, 2026Weeklyrss.com/podcasts/withintentionbycamisophiapodcastindex.org
Sex Advice for Seniors PodcastSuzanne Noble220October 29, 2026Weeklysexadviceforseniors.com/podcastpodcastindex.org
Hey Docs!Jill Allen220October 29, 2026Weeklyspreaker.com/show/hey-docshttps://www.spreaker.com/show/5647939/episodes/feedpodcastindex.org
Jillian on LoveDaylight Media220October 26, 2026Weeklyqcodemedia.com/jillian-on-lovehttps://feeds.megaphone.fm/QCD9197519710podcastindex.org
The Laura Dowling ExperienceLaura Dowling220October 29, 2026Weeklyfabuwellness.compodcastindex.org
Real WellnessSheri Traxler220October 30, 2026Weeklyshows.acast.com/real-wellnesspodcastindex.org
Judith Mancini TodayTalk 4 Podcasting220October 23, 2026Weeklyspreaker.com/show/judith-mancini-todayhttps://www.spreaker.com/show/5505350/episodes/feedpodcastindex.org
Pursuit of WellnessMari Llewellyn & Pursuit Network220October 28, 2026Weeklymarillewellyn.comhttps://feeds.megaphone.fm/SSM3257074871podcastindex.org
Let's Get Physical (Therapy)Becca Schumer220October 27, 2026Weeklymedstarhealth.org/news-and-publications/podcasts/lets-get-physicalhttps://rss.buzzsprout.com/2125045.rsspodcastindex.org
Pelvic Floor, Core & More | Healing Beyond Kegels: Core Rehab, Prenatal Fitness, Birth Prep, Postpartum Recovery, Nervous System Regulation, and Holistic Self-CDr. Desiree Cassell | Pelvic Floor Physical Therapist, Women’s Health Specialist, Strong and Fit Momma220October 28, 2026Weeklythebalancedmomtality.podbean.comhttps://feed.podbean.com/thebalancedmomtality/feed.xmlpodcastindex.org
All About You With Dr Shauna WattsDr Shauna Watts220October 25, 2026Weeklyallaboutyoupod.comhttps://anchor.fm/s/f1dad15c/podcast/rsspodcastindex.org
Zenith Fit HQ PodcastZenith Fit220October 28, 2026Several times a weekzenithfit.co.ukhttps://anchor.fm/s/fbae5e9c/podcast/rsspodcastindex.org
Health Care RoundsDarwin Research Group220October 30, 2026Every two weeksdarwinresearch.com/podcasthttps://rss.buzzsprout.com/2649901.rsspodcastindex.org
Center Point with Ran D. Anbar, MDUnderstanding Your Subconscious220October 16, 2026Weeklycenterpointhypnosis.comhttps://anchor.fm/s/d73b7234/podcast/rsspodcastindex.org
Iamstuffed_eating disorder podcastIamstuffed_eating disorder podcast219October 16, 2026Every two weeksiamstuffed.nlhttps://anchor.fm/s/1fa70700/podcast/rsspodcastindex.org
Sarasota Memorial HealthCastsSarasota Memorial HealthCasts219October 22, 2026Every two weekssmh.com/podcasthttps://feeds.simplecast.com/D2kMwduepodcastindex.org
Finding Traction: Recovery from PornVern Tompke - Porn Recovery Coach219October 22, 2026Every two weeksspreaker.com/show/finding-traction-recovery-from-pornhttps://www.spreaker.com/show/4360430/episodes/feedpodcastindex.org
Second Peak with Mitchel Schwindt, M.D.Mitchel Schwindt, M.D. | author | coaching | consulting219October 27, 2026Every two weeksmitchelschwindt.compodcastindex.org
Walking Home From The ICUKali219October 4, 2026Every two weeksdaytonicuconsulting.comhttps://anchor.fm/s/12e55da0/podcast/rsspodcastindex.org
Primary Care UpdateMark Ebell219October 30, 2026Every two weekspodcasters.spotify.com/pod/show/primary-care-updatehttps://anchor.fm/s/5693a5c/podcast/rsspodcastindex.org
everymumCormac Cahill219October 6, 2026Every two weekseverymum.iepodcastindex.org
Diabetes Dialogue: Technology, Therapeutics, & Real-World PerspectivesDiabetes Dialogue: Technology, Therapeutics, & Real-World Perspectives219October 27, 2026Every two weekshcplive.com/podcasts/diabetes-dialoguehttps://audioboom.com/channels/5030514.rsspodcastindex.org
Thriving After TraumaJaci Rogash219October 26, 2026Every two weeksbuzzsprout.com/1751525https://rss.buzzsprout.com/1751525.rsspodcastindex.org
The Brainy MomsDr. Amy Moore219October 20, 2026Every two weeksthebrainymoms.comhttps://rss.buzzsprout.com/1632949.rsspodcastindex.org
Raw Real Redeemed PodcastRaw Real Redeemed219September 21, 2026Every two weeksrawrealredeemed.comhttps://www.3mainegirls.com/feed.xmlpodcastindex.org
The Infinite ProjectStephen Gauld219October 29, 2026Weeklyinfiniteproject.com/infinite90https://feeds.transistor.fm/the-infinite-projectpodcastindex.org
The Peptide PodcastThe Peptide Queen219October 29, 2026Weeklypepties.comhttps://feeds.libsyn.com/417458/rsspodcastindex.org
Let's Be Real: Mama JourneysNikki Brooker219October 26, 2026Weeklysites.libsyn.com/418556https://feeds.libsyn.com/418556/rsspodcastindex.org
The Great Birth RebellionDr Melanie Jackson219October 25, 2026Weeklymelaniethemidwife.com/podcasts/the-great-birth-rebellionhttps://rss2.flightcast.com/jcult9wy1ey81bgbiczdjy68.xmlpodcastindex.org
Parenting Post-Wilderness: Parenting a Struggling Teen Before, During and After TreatmentBeth Hillman | Parent Coach for Parents of Struggling Teens219October 27, 2026Weeklybethhillmancoaching.comhttps://rss.buzzsprout.com/2021352.rsspodcastindex.org
Medicare MomentsJennifer Otto219October 28, 2026Weeklymedicare-moments.sounder.fmhttps://www.omnycontent.com/d/playlist/5e27a451-e6e6-4c51-aa03-a7370003783c/784dd5b1-58e5-4b72-988c-af4600fe26df/d298527b-27e3-4a8f-b7d6-af4600fe8d9d/podcast.rsspodcastindex.org
Performance PeopleGeorgie Ainslie219October 27, 2026Weeklyperformancepeoplepodcast.compodcastindex.org
UroNurseUroNurse219October 24, 2026Weeklyuronurse.com/index.htmlhttps://anchor.fm/s/e3d62174/podcast/rsspodcastindex.org
The Holistic Fertility ShowMike Berkley219October 28, 2026Several times a weekberkleycenter.comhttps://rss.buzzsprout.com/2424689.rsspodcastindex.org
Healing Mile | Walking for Mental Health, Happiness & Personal GrowthCarrie King | Healing Mile219August 28, 2026Several times a weekthehealingmile.comhttps://rss.buzzsprout.com/2497494.rsspodcastindex.org
Stephen Dalton Sleep StoriesStephen Dalton219October 29, 2026Weeklyhttps://feeds.megaphone.fm/GSGP2041266061podcastindex.org
Mental Health Today Show | Mental Wellness & OverthinkingJohn Cordray, LPC | Overthinking & Mental Wellness Expert218October 14, 2026Monthlymentalhealthtodayshow.comhttps://feeds.redcircle.com/7a9eb6f1-12aa-47ef-a210-df79b8a0c5f3podcastindex.org
Christian Healthy Lifestyle: Health Tips That Promote Wellness - Longevity - Fitness - Mental Health and Spiritual GrowthDavid Sandstrom218September 30, 2026Every two weekschristianhealthylifestyle.mykajabi.com/podcasts/christian-healthy-lifestyle-healhttps://app.kajabi.com/podcasts/2147953281/feedpodcastindex.org
Muscle Science for WomenAshleigh VanHouten | Rachel Gregory218October 27, 2026Every two weeksmusclescienceforwomen.comhttps://paleomagazine.libsyn.com/rsspodcastindex.org
The Over 40 Alpha PodcastFunk Roberts218October 31, 2026Every two weeksover40alpha.comhttps://feeds.captivate.fm/the-over-40-alpha/podcastindex.org
The Stress Nanny with Lindsay MillerLindsay Miller218September 4, 2026Every two weeksthestressnanny.comhttps://rss.buzzsprout.com/622546.rsspodcastindex.org
Psychology Has It BackwardsChristine Heath and Judy Sedgeman218October 24, 2026Every two weekspsychologyhasitbackwards.comhttps://rss.buzzsprout.com/987052.rsspodcastindex.org
Direct Access to Oxford Physical TherapyOxford Physical Therapy218October 23, 2026Every two weeksbuzzsprout.com/1431562https://rss.buzzsprout.com/1431562.rsspodcastindex.org
The Joanne Avison PodcastJoanne Avison218October 30, 2026Every two weeksjoanneavison.comhttps://rss.buzzsprout.com/1262273.rsspodcastindex.org
Dietitian ValuesLaura Jean218October 22, 2026Every two weeksdietitianvalues.buzzsprout.comhttps://rss.buzzsprout.com/1773663.rsspodcastindex.org
TODAYNBC News218October 30, 2026Every two weeksnbcnews.comhttps://podcastfeeds.nbcnews.com/TODAYpodcastindex.org
The DNA Talks PodcastThe DNA Company218October 28, 2026Every two weeksbuzzsprout.com/1870029https://rss.buzzsprout.com/1870029.rsspodcastindex.org
Spotlight on DarkcastDarkcast Network218October 26, 2026Weeklydarkcastnetwork.comhttps://feeds.megaphone.fm/SGMKL4107966790podcastindex.org
Desire Too InspireDesire Too Inspire218October 30, 2026Every two weeksdesiretooinspireritenau.comhttps://anchor.fm/s/7dff2b70/podcast/rsspodcastindex.org
The Lympha Press PodcastLympha Press218October 22, 2026Every two weekslymphapress.comhttps://anchor.fm/s/62866aac/podcast/rsspodcastindex.org
How To Deal With Grief and TraumaNathalie Himmelrich218October 22, 2026Weeklynathaliehimmelrich.comhttps://rss.buzzsprout.com/2004945.rsspodcastindex.org
Vanilla To VixenMr & Mrs N (naughtycp1)218October 30, 2026Weeklyvanillatovixen.podbean.comhttps://feed.podbean.com/vanillatovixen/feed.xmlpodcastindex.org
The Gymnast Nutritionist® PodcastChristina Anderson MS, RDN, CSSD, CSP218October 26, 2026Weeklychristinaandersonrdn.comhttps://rss.buzzsprout.com/2027449.rsspodcastindex.org
Gray MattersHailee Piendl218October 27, 2026Weeklyyoungandwyld.comhttps://api.riverside.com/hosting/iAPq5H9k.rsspodcastindex.org
Sports Will Save Us All | A Sports Podcast Where Sports Are Just the BeginningSasha Graham218August 11, 2026Weeklysportswillsaveusall.comhttps://feeds.libsyn.com/441489/rsspodcastindex.org
Sowing ProsperityLogan Duvall218October 4, 2026Weeklysowingprosperity.com/podcasts/sowing-prosperityhttps://app.kajabi.com/podcasts/2147508591/feedpodcastindex.org
Enlightened Empowered Evolved PodcastLoot Bryon Smith218October 22, 2026Weeklyyoutube.com/@333empowerhttps://www.podserve.fm/series/rss/6950/enlightened-empowered-evolved-podcast.rsspodcastindex.org
Your Money, Your Rules | Financial Mastery, Wealth Mindset, Leadership Principles, Intuitive Decision-Making, Human DesignErin Gray | Holistic Advisor for Entrepreneurs, Former CFP and CFO218October 29, 2026Weeklygeneratealifewelllived.com/podcasthttps://rss.buzzsprout.com/2162344.rsspodcastindex.org
Reasons We Serve: Police Careers & Officer ExperienceReasons We Serve218October 25, 2026Weeklyspreaker.com/podcast/reasons-we-serve-police-careers-officer-experience--5841971https://www.spreaker.com/show/5841971/episodes/feedpodcastindex.org
Empower U 2 PodcastNatasha Paris- Empowerment Strategist218October 21, 2026Weeklyempoweru2podcast.buzzsprout.comhttps://rss.buzzsprout.com/2202825.rsspodcastindex.org
The Personal Success Podcast with Ryan WattsRyan Watts218October 28, 2026Weeklyryanwattscoaching.com/podcasts/the-personal-success-podcast-with-ryan-wattshttps://app.kajabi.com/podcasts/2147580772/feedpodcastindex.org
The Gary Zukav DeepcastGary Zukav218October 30, 2026Several times a weekseatofthesoul.com/podcasthttps://feeds.megaphone.fm/IIOTE9468089069podcastindex.org
The Unbroken With Sam DavisMan Road Media218October 30, 2026Several times a weekmanroadmedia.podbean.comhttps://feed.podbean.com/Manroadmedia/feed.xmlpodcastindex.org
Mindful, Beautiful, and ThrivingTaarika Foundation217October 18, 2026Every two weekssoundcloud.com/mindfulbeautifulthrivinghttps://feeds.soundcloud.com/users/soundcloud:users:821458609/sounds.rsspodcastindex.org
Scissors N Scrubs: The $#!t Nurses SeeNurse Podcast About Nursing217October 14, 2026Every two weeksscissorsnscrubs.podbean.comhttps://feed.podbean.com/scissorsnscrubs/feed.xmlpodcastindex.org
PT Pro TalkMariana Hanna Parks217October 27, 2026Every two weeksptprotalk.comhttps://anchor.fm/s/1e3613d4/podcast/rsspodcastindex.org
Citizens of the World: A Stoic Podcast for Curious TravelersCommunication & Mindset Coach Sarah Mikutel217September 8, 2026Every two weekssarahmikutel.comhttps://rss.buzzsprout.com/694066.rsspodcastindex.org
Performance Talk with Dr. Ewell GordonEEG3 Enterprises, LLC217October 26, 2026Every two weeksfeeds.megaphone.fm/performancetalkhttps://feeds.megaphone.fm/performancetalkpodcastindex.org
One Small BiteDavid Orozco217October 28, 2026Every two weeksonesmallbite.nethttps://rss.buzzsprout.com/679691.rsspodcastindex.org
Daily Spark with Dr. Angela (radio)Dr. Angela Butts Chester217October 30, 2026Weeklydrangelachester.com/daily-spark-radiohttps://www.spreaker.com/show/2571378/episodes/feedpodcastindex.org
Move Your DNA with Katy BowmanNutritious Movement217October 30, 2026Monthlynutritiousmovement.com/articles/category/podcast-transcriptshttps://feeds.transistor.fm/move-your-dna-with-katy-bowmanpodcastindex.org
Harrison's PodClass: Internal Medicine Cases and Board PrepAccessMedicine217October 22, 2026Every two weeksaccessmedicine.mhmedical.comhttps://rss.buzzsprout.com/259885.rsspodcastindex.org
Body Smart PodcastJaymie Moran & Stacey Jones - Body Smart Fitness217October 28, 2026Every two weeksbodysmartfitness.comhttps://rss.buzzsprout.com/1722207.rsspodcastindex.org
The Carrie Abbott ShowCarrie Abbott217October 30, 2026Dailythelegacyinstitute.comhttps://feeds.feedburner.com/CarrieAbbottRadiopodcastindex.org
Secular AA's Podcastsecular AA217October 12, 2026Every two weekssecularaa.buzzsprout.comhttps://rss.buzzsprout.com/1536487.rsspodcastindex.org
Feisty Women's PerformanceDr. Erin Ayala217October 26, 2026Every two weekslivefeisty.com/category/podcasts/feisty-womens-performance-podcasthttps://feeds.captivate.fm/the-womens-performance-podcast/podcastindex.org
Shamelessly Ambitious I Helping Ambitious Women Prevent Burnout + Create Nervous System First Success in Business, Motherhood, & LifeAshley McDonald, Therapist & Nervous System First Business Mentor217October 27, 2026Every two weeksashmcdonaldmentoring.comhttps://rss.buzzsprout.com/2188576.rsspodcastindex.org
The Lakeview PodcastLake217October 25, 2026Weeklybuzzsprout.com/1976461https://rss.buzzsprout.com/1976461.rsspodcastindex.org
SelfdomDominique Elissa217October 27, 2026Weeklyselfdom.auhttps://rss2.flightcast.com/rjfmqzjzcr1tbv9g21gspk33.xml/podcastindex.org
My journey with Parkinson'sSue Waight217October 25, 2026Several times a weekparkiesandme.comhttps://anchor.fm/s/fcb84f14/podcast/rsspodcastindex.org
Maintaining You: Health is WealthRukky Arutere217October 31, 2026Dailypodcasters.spotify.com/pod/show/rukkyaruterehttps://anchor.fm/s/10efd2ba4/podcast/rsspodcastindex.org
Stories from the WaterShannon Keegan founder of Intrepid Water216October 15, 2026Every two weeksintrepidwater.comhttps://rss.buzzsprout.com/1083881.rsspodcastindex.org
PeerVoice Clinical Pharmacology AudioPeerVoice, 1140 Avenue of the Americas, 15th Floor, New York, NY 10036216October 30, 2026Weeklypeervoice.comhttps://c.peervoice.com/podcast/xml/clinical_pharmacology_audio.xmlpodcastindex.org
Alison Answers #MissionAwakeAlison Lager LCSW, CASAC216October 7, 2026Every two weekslagercounseling.comhttps://rss.buzzsprout.com/885475.rsspodcastindex.org
Living With Cystic FibrosisThe Bonnell Foundation216October 26, 2026Every two weeksthebonnellfoundation.org/audio-podcastshttps://feeds.simplecast.com/9p8q_0Xopodcastindex.org
Nutritional Revolution Podcast with Kyla Channell, MScKyla Channell, MSc Nutrition & Human Performance216October 28, 2026Every two weeksnutritional-revolution.comhttps://rss.buzzsprout.com/986440.rsspodcastindex.org
Financially Savvy in 20 minutesNatalie Torres-Haddad216October 30, 2026Every two weeksaudioboom.com/channels/4946291https://audioboom.com/channels/4946291.rsspodcastindex.org
Barbells and BanterSTCfit216October 27, 2026Every two weeksstcfit.comhttps://anchor.fm/s/e51cc5c4/podcast/rsspodcastindex.org
The SweatSimple PodcastBrooks Hurbis216October 29, 2026Every two weekssweatsimpleco.comhttps://anchor.fm/s/4ba29644/podcast/rsspodcastindex.org
Fit Mother Project PodcastFit Mother Project216October 30, 2026Every two weeksfitmotherproject.comhttps://feeds.captivate.fm/fit-mother-project/podcastindex.org
Ideal PracticeWendy Pitts Reeves216October 27, 2026Weeklywendypittsreeves.comhttps://rss.buzzsprout.com/1977428.rsspodcastindex.org
Voices of Women PhysiciansTatyana Reznik MD, FACP216October 31, 2026Weeklyjoyfulsuccessliving.comhttps://rss.buzzsprout.com/2006117.rsspodcastindex.org
Veteran's Affairs Plus W/ David L. WashingtonDavid L. Washington216October 31, 2026Every two weekskunv.orghttps://feeds.transistor.fm/veterans-affairs-pluspodcastindex.org
The Observatory | Discovery of Consciousness & AwarenessNC Productions www.NCP.media216October 29, 2026Weeklyspreaker.com/s/5BqDuRHy1U9Whttps://www.spreaker.com/show/5655534/episodes/feedpodcastindex.org
Your Favorite YouMelissa Parsons216October 27, 2026Weeklyyourfavoriteyou.buzzsprout.comhttps://rss.buzzsprout.com/2054305.rsspodcastindex.org
Golden Hour Adventures PodcastJustin Andreas & Robbie Pike216October 26, 2026Weeklygoldenhouradventures.podbean.comhttps://feed.podbean.com/goldenhouradventures/feed.xmlpodcastindex.org
Golden Hour Adventures PodcastJustin Andreas & Robbie Pike216October 26, 2026Weeklygoldenhouradventures.podbean.comhttps://goldenhouradventures.podbean.com/feed.xmlpodcastindex.org
IF MAMA AIN’T HEALTHY (AIN’T NOBODY HEALTHY) - Christian Wellness, Metabolic Health, Functional Health, Christian Women’s Functional Health Coaching - formerly Lori Morris, CNM, MSN - Lori Morris | Christian Midwife & Faith-Based Wellness Coach216October 27, 2026Weeklyyourbirthgodsway.podbean.comhttps://yourbirthgodsway.podbean.com/feed.xmlpodcastindex.org
IF MAMA AIN’T HEALTHY (AIN’T NOBODY HEALTHY) - Christian Wellness, Metabolic Health, Functional Health, Christian Women’s Functional Health Coaching - formerly Lori Morris, CNM, MSN - Lori Morris | Christian Midwife & Faith-Based Wellness Coach216October 27, 2026Weeklyyourbirthgodsway.podbean.comhttps://feed.podbean.com/yourbirthgodsway/feed.xmlpodcastindex.org
Evidence-Based Pilates PodcastDr. Adam McAtee, PT, DPT216October 23, 2026Weeklyevidence-basedpilates.com/pilates-club-2-week-free-trialhttps://anchor.fm/s/de45b4b8/podcast/rsspodcastindex.org
Hold The StandardHold The Standard215October 26, 2026Every two weekscrossfitcontessa.com.auhttps://anchor.fm/s/11a5150c/podcast/rsspodcastindex.org
Strength ChatSteven Cuthbert215October 29, 2026Every two weeksstrengthchat.podbean.comhttps://anchor.fm/s/f149afd8/podcast/rsspodcastindex.org
Delivering HealthJohn Neustadt ND215October 30, 2026Every two weeksnbihealth.comhttps://deliveringhealth.libsyn.com/rsspodcastindex.org
RadioGraphics Podcast | RSNARadiological Society of North America (RSNA)215October 20, 2026Every two weeksrsnaradiographics.libsyn.com/websitehttps://rsnaradiographics.libsyn.com/rsspodcastindex.org
ASHA VoicesAmerican Speech-Language-Hearing Association (ASHA)215October 22, 2026Every two weekshttps://feeds.blubrry.com/feeds/asha_voices.xmlpodcastindex.org
The Art Of Listening To Your BodyJin Ong215October 27, 2026Every two weekstheartoflisteningtoyourbody.comhttps://feed.pod.co/theartoflisteningtoyourbodypodcastindex.org
The Self Help AntidoteBobby Cappuccio215October 28, 2026Every two weekstheselfhelpantidote.buzzsprout.comhttps://rss.buzzsprout.com/1667158.rsspodcastindex.org
Meditation MountainGuided Meditation215October 26, 2026Every two weekspodcasters.spotify.com/pod/show/meditation-mountainpodcastindex.org
The Improvement PodcastCharlie Cuthbert215September 30, 2026Every two weeksrss.com/podcasts/theimprovementpodcasthttps://media.rss.com/theimprovementpodcast/feed.xmlpodcastindex.org
Taylor Brain BytesArlene R Taylor215October 18, 2026Every two weekspodcasters.spotify.com/pod/show/arlene-r-taylorhttps://anchor.fm/s/37c1e468/podcast/rsspodcastindex.org
The Big SilenceKarena Dawn215August 20, 2026Weeklythebigsilence.comhttps://rss2.flightcast.com/nylotet4jb2u3v385huslnuq.xml/podcastindex.org
Giving You a Fresh Start After Trauma! Walk in Peace & Joy! Be Free Emotionally!Regina Sanchez215October 28, 2026Every two weekssites.libsyn.com/362552https://feeds.libsyn.com/362552/rsspodcastindex.org
Two Onc DocsSam and Karine215October 26, 2026Weeklybuzzsprout.com/1914796https://rss.buzzsprout.com/1914796.rsspodcastindex.org
The Pod of Inquiry The Podcast For Human Optimization And UnderstandingDr. Stephen L. Barrett215October 23, 2026Weeklypodofinquiry.comhttps://feeds.libsyn.com/426887/rsspodcastindex.org
The Golden SpoonMcCahill & Jeremy215October 29, 2026Weeklythegoldenspoon.buzzsprout.comhttps://rss.buzzsprout.com/2051412.rsspodcastindex.org
The Sex Reimagined PodcastLeah Piper and Dr. Willow Brown215October 27, 2026Weeklysexreimagined.comhttps://rss.buzzsprout.com/2032242.rsspodcastindex.org
Reproductive RebelAdrienne Irizarry, HWH215October 27, 2026Weeklymoonessence.lifehttps://rss.buzzsprout.com/2087965.rsspodcastindex.org
Giving You a Fresh Start After Trauma! Walk in Peace & Joy! Be Free Emotionally!Regina Sanchez215October 28, 2026Every two weekssites.libsyn.com/362552https://freshstart2021.libsyn.com/rsspodcastindex.org
Tennis Talk 101John Thompson215October 26, 2026Weeklybuzzsprout.com/2395749https://rss.buzzsprout.com/2395749.rsspodcastindex.org
On The Pen GLP-1 NewsDave Knapp GLP-1 Industry Insider215October 27, 2026Weeklyotplinks.comhttps://anchor.fm/s/11017aac8/podcast/rsspodcastindex.org
Talk Shit With PTSWP215September 30, 2026Every two weekstalkshitwithp.buzzsprout.comhttps://rss.buzzsprout.com/1028638.rsspodcastindex.org
Working Like Dogs - Service Dogs and Working Dogs - Pet Life Radio OriginalPet Life Radio214October 26, 2026Monthlyspreaker.com/podcast/working-like-dogs-service-dogs-and-working-dogs-pets-animalhttp://feeds2.feedburner.com/Petliferadiocom-WorkingLikeDogspodcastindex.org
Neurocritical Care Society PodcastEducation Neurocritical Care214October 28, 2026Monthlyneurocriticalcare.org/Events/Event-Calendar/Podcastshttps://ncspodcast.libsyn.com/rsspodcastindex.org
Urology Care PodcastUrology Care Podcast214September 30, 2026Monthlyurologyhealth.orghttp://feeds.feedburner.com/UrologyCarePodcastpodcastindex.org
The Transformation StationChristina Romita214October 30, 2026Weeklythetransformationstation.cahttps://www.spreaker.com/show/4156450/episodes/feedpodcastindex.org
Behind Beautiful ThingsForthHand214October 27, 2026Every two weeksart19.com/shows/behind-beautiful-thingshttps://rss.art19.com/behind-beautiful-thingspodcastindex.org
The Ready State PodcastKelly Starrett & Juliet Starrett214October 22, 2026Every two weeksthereadystate.comhttps://feeds.blubrry.com/feeds/mobilitywod.xmlpodcastindex.org
Hustle and Pro - Frisco's Sports PodcastKelly Walker214October 25, 2026Every two weekshustleandpro.comhttps://feeds.castos.com/noodqpodcastindex.org
HelixTalk - Rosalind Franklin University's College of Pharmacy PodcastSean P. Kane, PharmD, BCPS214October 9, 2026Monthlyhelixtalk.comhttps://helixtalk.libsyn.com/rsspodcastindex.org
The Sweet Empowerment Podcast - Reclaim your personal power!Kristen L. Brown214October 14, 2026Every two weekskristenbrown.orghttps://rss.buzzsprout.com/2598501.rsspodcastindex.org
Binge Eating Dietitian PodcastDr. Joanne Moscalu Ed.D RD214October 22, 2026Every two weeksbingeeatingdietitian.comhttps://rss.buzzsprout.com/1519369.rsspodcastindex.org
Escaping Narcissist MothersMilly214October 9, 2026Every two weeksnarcissisticfamily.podbean.comhttps://rss.buzzsprout.com/2116561.rsspodcastindex.org
Tales to InspireKrish Patel214October 29, 2026Every two weekstalestoinspire.libsyn.com/websitehttps://talestoinspire.libsyn.com/rsspodcastindex.org
Energy Work: Clear Your Blocks, Activate Your Power, Manifest Your Dream LifeGeorge Lizos214October 30, 2026Every two weeksgeorgelizos.com/podcastpodcastindex.org
Faisel and Friends: A Primary Care PodcastFaisel Syed214October 29, 2026Every two weekshttps://feeds.transistor.fm/faisel-and-friends-a-primary-care-podcastpodcastindex.org
The Otaku Collective PodcastOtaku Collective Podcast214October 29, 2026Every two weeksrss.com/podcasts/otakucollectivehttps://media.rss.com/otakucollective/feed.xmlpodcastindex.org
HER HOLISTIC HEALING, Christian Wellness, Holistic Health, Autoimmune Disease, Exhaustion, Faith-Based HealthAlexandra Yu-Christian Health Coach, Registered Nurse, Faith & Holistic Health214October 21, 2026Weeklyherholistichealing.comhttps://feed.podbean.com/herholistichealing/feed.xmlpodcastindex.org
HER HOLISTIC HEALING, Christian Wellness, Holistic Health, Autoimmune Disease, Exhaustion, Faith-Based HealthAlexandra Yu-Christian Health Coach, Registered Nurse, Faith & Holistic Health214October 21, 2026Weeklyherholistichealing.comhttps://herholistichealing.podbean.com/feed.xmlpodcastindex.org
Faith to Witness 99Kathryn Bise214October 28, 2026Weeklyredcircle.com/shows/faith-to-witness-99https://feeds.redcircle.com/8058c7e4-b674-4626-ad76-3b263959c400podcastindex.org
The Well Nourished PodcastMelissa Eich214October 29, 2026Weeklymelissaeichcoaching.com/the-podcasthttps://rss.buzzsprout.com/2230541.rsspodcastindex.org
Wellness: Rebranded - Intuitive eating, diet culture, mental health, weight training, food freedom, food relationshipElizabeth Harris, Tara De Leon, Maria Winters214October 28, 2026Weeklywellnessrebranded.podbean.comhttps://feed.podbean.com/wellnessrebranded/feed.xmlpodcastindex.org
Wellness: Rebranded - Intuitive eating, diet culture, mental health, weight training, food freedom, food relationshipElizabeth Harris, Tara De Leon, Maria Winters214October 28, 2026Weeklywellnessrebranded.podbean.comhttps://wellnessrebranded.podbean.com/feed.xmlpodcastindex.org
Treat Your BusinessKatie Bell214October 28, 2026Weeklythrive-businesscoaching.comhttps://rss.buzzsprout.com/2090945.rsspodcastindex.org
Doctors Take the MicGloria Wu, MD214October 12, 2026Weeklysites.libsyn.com/456432https://feeds.libsyn.com/456432/rsspodcastindex.org
Neurocritical Care Society PodcastEducation Neurocritical Care214October 28, 2026Monthlyneurocriticalcare.org/Events/Event-Calendar/Podcastshttps://rss.libsyn.com/shows/99552/destinations/521463.xmlpodcastindex.org
For the Love of Hormones- Miscarriage, Hormone Balance, Progesterone, TTC, Cycle Tracking, Conception, Holistic HealthBekah Yawn I Christian Hormone & Ovulation Coach, FEMM Educator, Certified Doula, Fiat Institute214October 29, 2026Weeklybekahyawn.comhttps://api.riverside.com/hosting/qYTazXQ6.rsspodcastindex.org
Authentically Kinky Podcast powered by Clips4SaleAuthentically Kinky214October 30, 2026Weeklyauthenticallykinky.comhttps://anchor.fm/s/fa9049e4/podcast/rsspodcastindex.org
Parent Pausewith Kim McCabe (because a pause is not a luxury)214October 9, 2026Several times a weekkimmccabe.substack.com/podcastpodcastindex.org
SoundPracticeAmerican Association for Physician Leadership®213October 28, 2026Every two weekssoundpractice.comhttps://www.soundpractice.com/feed.xmlpodcastindex.org
Brain over Binge PodcastKathryn Hansen213October 19, 2026Monthlybrainoverbinge.com/bobpodcasthttps://feeds.libsyn.com/88684podcastindex.org
Live Train PerformShaun Kober213October 16, 2026Every two weekslivetrainperform.buzzsprout.comhttps://rss.buzzsprout.com/1082945.rsspodcastindex.org
Burn it Nutrition PodcastBurn it Nutrition213September 21, 2026Monthlyburnitnutrition.comhttps://burnitnutrition.libsyn.com/rsspodcastindex.org
Health:FurtherMarcus Whitney & Vic Gatto213October 30, 2026Weeklyjumpstarthealth.co/health-further-podcasthttps://feeds.transistor.fm/health-furtherpodcastindex.org
Everyday Medicine with Dr LukeDr Luke Crantock213October 26, 2026Every two weeksgihealth.com.auhttps://anchor.fm/s/2f42168c/podcast/rsspodcastindex.org
Life's Essential IngredientsJeff Christian and Mike Sestich213October 29, 2026Every two weeksc4leaders.orghttps://rss.buzzsprout.com/1497766.rsspodcastindex.org
The Midlife FeastJenn Salib Huber RD ND213October 26, 2026Every two weeksjennsalibhuber.cahttps://rss.buzzsprout.com/1851576.rsspodcastindex.org
2 Sober Girls PodcastErinn + Michaela213October 26, 2026Weeklyart19.com/shows/2-sober-girlshttps://rss.art19.com/2-sober-girlspodcastindex.org
MTNTOUGH Podcast w/ Dustin DiefenderferDustin Diefenderfer Founder and CEO of MTNTOUGH Fitness213October 22, 2026Less than monthlymtntough.comhttps://anchor.fm/s/eff1d994/podcast/rsspodcastindex.org
Please Me! A Sexuality PodcastEve Hall213October 23, 2026Weeklypleaseme.onlinehttps://feeds.megaphone.fm/TEPED8102819000podcastindex.org
Extend Podcast with Darshan Shah, MDDarshan Shah, MD213October 29, 2026Several times a weekdrshah.comhttps://feeds.libsyn.com/551312/rsspodcastindex.org
The Grace Fueled Wife: Christian Marriage Podcast, Rebuild Emotional Intimacy, Healthy Communication, Conflict ResolutionBeatriz Vargas213October 21, 2026Every two weeksthegracefueledwife.comhttps://feeds.captivate.fm/the-grace-fueled-wife/podcastindex.org
Bevin: A Femme Over 40 and her FriendsBevin212August 30, 2026Every two weeksfatkiddanceparty.comhttps://anchor.fm/s/88114d0/podcast/rsspodcastindex.org
#moldfinders: RADIOBrian Karr212October 7, 2026Every two weekspodcasters.spotify.com/pod/show/moldfindershttps://anchor.fm/s/214f3d70/podcast/rsspodcastindex.org
Fierce Fatty Podcast with Vinny WelsbyVinny Welsby212October 13, 2026Every two weeksfiercefatty.comhttps://fiercefatty.libsyn.com/rsspodcastindex.org
HIListically Speaking with Hilary RussoHilary Russo212September 30, 2026Every two weekshilaryrusso.com/podcasthttps://hilisticallyspeaking.libsyn.com/rsspodcastindex.org
a line within podcastAshley Hämäläinen212October 28, 2026Every two weeksalnwithin.com/podcasthttps://thelinepodcast.libsyn.com/rsspodcastindex.org
Love Sober PodcastKate Baily212October 29, 2026Every two weekslovesober.podbean.comhttps://feed.podbean.com/lovesober/feed.xmlpodcastindex.org
Psychedelic Medicine Podcast with Dr. Lynn Marie MorskiLynn Marie Morski212October 21, 2026Every two weekspsychedelicmedicineassociation.org/podcastshttps://plantmedicinepodcast.libsyn.com/rsspodcastindex.org
Imagine Yourself PodcastImagine Yourself Podcast212October 29, 2026Every two weeksimagineyourselfpodcast.comhttps://rss.buzzsprout.com/898144.rsspodcastindex.org
The "What's Your Revolution?" Show with Dr. Charles Corprew"Dr. Charles Corprew212September 15, 2026Monthlywyrevolution.comhttps://feeds.soundcloud.com/users/soundcloud:users:20943519/sounds.rsspodcastindex.org
The AUScelerate PodcastAUScelerate212September 23, 2026Every two weeksauscelerate.orghttps://rss.buzzsprout.com/259045.rsspodcastindex.org
Arthritis At Home (+ On the Go)Arthritis Consumer Experts212October 29, 2026Every two weeksbuzzsprout.com/1182689https://rss.buzzsprout.com/1182689.rsspodcastindex.org
Today is the Day ChangemakersJodi212October 31, 2026Every two weekstodayisthedayliveit.comhttps://rss.buzzsprout.com/1534696.rsspodcastindex.org
We're All InsaneDevorah Roloff212October 25, 2026Weeklydocs.google.com/forms/d/16f917tWulHv0UDPtuWdO4WtOCiojOx51TUUfCRzBIug/edithttps://feeds.megaphone.fm/TPC6335966983podcastindex.org
The Picture of WealthDustin Serviss212October 22, 2026Every two weeksthepictureofwealth.com/podcasthttps://feeds.cohostpodcasting.com/cDQOfnvSpodcastindex.org
Effortless BeingDeandra Serrano212October 29, 2026Every two weeksbuzzsprout.com/1796760https://rss.buzzsprout.com/1796760.rsspodcastindex.org
PetiteStacy ASMRStacy212September 3, 2026Every two weeksyoutube.com/PetiteStacyhttps://anchor.fm/s/74a37e78/podcast/rsspodcastindex.org
Good PizzZa PodcastJPeezy212October 27, 2026Weeklygoodpizzza.comhttps://rss.buzzsprout.com/1968982.rsspodcastindex.org
Other Side LifestyleJIm Hallinan and Aram Grigorian212October 29, 2026Weeklysites.libsyn.com/410084https://rss.libsyn.com/shows/410084/destinations/3396425.xmlpodcastindex.org
Getting After ItBrett Rossell212October 29, 2026Weeklykeepgettingafterit.comhttps://rss.buzzsprout.com/2030464.rsspodcastindex.org
The PhD Life CoachVikki Wright212October 26, 2026Weeklythephdlifecoach.comhttps://rss.buzzsprout.com/1992545.rsspodcastindex.org
Think Before BedMark212October 16, 2026Weeklyredcircle.com/shows/think-before-bedhttps://feeds.redcircle.com/023f73bd-0dd6-4589-bd11-69e2c6c0a7d9podcastindex.org
Flip Your MindsetStacey Uhrig212October 26, 2026Every two weeksflipyourmindset.substack.com/podcastpodcastindex.org
Vibing with E®Erica Lashai212October 28, 2026Weeklyapp.podcastpage.io/settings/vibing-with-e/customize/livehttps://media.rss.com/vibingwithe/feed.xmlpodcastindex.org
Weight Loss After 50 | Menopause, Healthy Eating, Pain Relief, Keto Diet, Prediabetes, HormonesRobyn Polk | Faith-Led Weight Loss Coach to Women Over 50212October 29, 2026Weeklyweightlossafter50.podbean.comhttps://feed.podbean.com/weightlossafter50/feed.xmlpodcastindex.org
Lifeline to VitalityJarek Esarco, DC, CACCP211October 6, 2026Every two weeksohiospecific.comhttps://rss.buzzsprout.com/340628.rsspodcastindex.org
Knocked Up: All About Fertility and Women's HealthWomen's Health Melbourne211October 25, 2026Every two weekswomenshealthmelbourne.com.au/category/podcasthttps://anchor.fm/s/114e45c7c/podcast/rsspodcastindex.org
SEE YOU NOWJohnson & Johnson211October 27, 2026Every two weeksnursing.jnj.com/see-you-now-podcasthttps://seeyounow.libsyn.com/rsspodcastindex.org
Patterns of Power with Craig Perra (habits, mindfulness, high-performance, self-leadership)The Mindful Habit® System211October 9, 2026Monthlymindfulhabitmastery.comhttps://www.spreaker.com/show/425544/episodes/feedpodcastindex.org
Making Life BrighterWinifred Adams211September 3, 2026Monthlysites.libsyn.com/597950https://rss.libsyn.com/shows/597950/destinations/5201310.xmlpodcastindex.org
Private Practice Survival GuideBrandon Seigel211October 29, 2026Every two weekswellnessworksmp.comhttps://rss.buzzsprout.com/2456403.rsspodcastindex.org
AGELESS HEALTH® with Dr. Tom Roselle, DCDr. Tom Roselle, DC211October 25, 2026Weeklydrtomroselle.com/ageless-health-podcasthttps://feeds.libsyn.com/453225/rsspodcastindex.org
OT Potential Podcast | Occupational Therapy CEUsSarah Lyon, OTR/L211October 30, 2026Every two weeksotpotential.comhttps://rss.buzzsprout.com/271865.rsspodcastindex.org
The Podiatry Business PodcastLorcan O Donaile, Podiatry Business Coach & Clinic Podiatrist211October 27, 2026Every two weeksmorepracticeprofits.comhttps://rss.buzzsprout.com/818647.rsspodcastindex.org
The Meaning ProjectDr. Daniel A. Franz211August 10, 2026Every two weeksdanielafranz.comhttps://www.spreaker.com/show/4305631/episodes/feedpodcastindex.org
Align + Attract with Kerry RowettKerry Rowett211October 1, 2026Every two weeksalignandattract.comhttps://rss.buzzsprout.com/1540993.rsspodcastindex.org
Your Extraordinary Life & Dating After DivorceSade Curry211October 6, 2026Every two weekssadecurry.comhttps://rss.buzzsprout.com/1593184.rsspodcastindex.org
Wellness 1®Audacy211October 24, 2026Every two weeksaudacy.com/podcast/allpodcastindex.org
Trying To Be Better with Joel and SteveTrying To Be Better Podcast211October 11, 2026Every two weeksttbbpodcast.podbean.comhttps://feed.podbean.com/ttbbpodcast/feed.xmlpodcastindex.org
Brother Be WellBrother Be Well211September 20, 2026Every two weeksbrotherbewell.buzzsprout.comhttps://rss.buzzsprout.com/1798808.rsspodcastindex.org
CALL ME MISTRESSMistress Mia Rey211October 30, 2026Weeklymiasdungeonshow.comhttps://anchor.fm/s/3536a6d4/podcast/rsspodcastindex.org
Aware and AggravatedAudioboom211October 4, 2026Every two weeksaudioboom.com/channels/5148285https://audioboom.com/channels/5148285.rsspodcastindex.org
THE DESI EM PROJECTAnkur Verma211October 14, 2026Every two weekspodcasters.spotify.com/pod/show/ankur-verma76https://anchor.fm/s/74a124e8/podcast/rsspodcastindex.org
The Mindset and Self-Mastery ShowNick McGowan211October 22, 2026Every two weeksthemindsetandselfmasteryshow.comhttps://themindsetandselfmasteryshow.com/feed/podcast/podcastindex.org
Running With JamesJames Wyatt211October 31, 2026Every two weeksmybcfit.comhttps://rss.buzzsprout.com/1953655.rsspodcastindex.org
Setting It Straight w/ Ms. GrayTalk 4 Podcasting211October 19, 2026Every two weekstalk4media.com/audio/7056https://www.spreaker.com/show/5437261/episodes/feedpodcastindex.org
I Never Knew (INK) But My Dog Did! By Lifecoach MaureenMaureen Scanlon211October 28, 2026Weeklylifecoachmaureen.comhttps://www.spreaker.com/show/5602763/episodes/feedpodcastindex.org
The 10 Ninety PodcastMason Sawyer211October 27, 2026Weeklysites.libsyn.com/423686https://feeds.libsyn.com/423686/rsspodcastindex.org
Healthy Teen LifeLeslie Rose | Life Coach for Teenagers and College Students211October 28, 2026Weeklyleslierosecoaching.com/podcasthttps://feeds.captivate.fm/healthy-teen-life/podcastindex.org
Run Your Story PodcastAllison Gaillard211October 28, 2026Weeklyrunyourstory.comhttps://rss.buzzsprout.com/2077335.rsspodcastindex.org
Brain Wellness - the PodcastMandi Swanson211October 30, 2026Weeklypodcasters.spotify.com/pod/show/mandi-counters1https://anchor.fm/s/c305dcb4/podcast/rsspodcastindex.org
(cosmic) flow states w/ Amanda BarnettBARNEY + FLOW | Living Into The New Paradigm211October 28, 2026Every two weeksbarney41g5v.substack.com/podcastpodcastindex.org
THE CONFIDENT BODY PODCAST - Brain-based strategies and self-compassion practices to unlock your full potentialLizzie Merritt - Weight Loss Coach for Women Who Want To Feel Confident In Their Own Skin211October 28, 2026Weeklyconfidentbody.coachhttps://theconfidentbodypodcast.podbean.com/feed.xmlpodcastindex.org
THE CONFIDENT BODY PODCAST - Brain-based strategies and self-compassion practices to unlock your full potentialLizzie Merritt - Weight Loss Coach for Women Who Want To Feel Confident In Their Own Skin211October 28, 2026Weeklyconfidentbody.coachhttps://feed.podbean.com/theconfidentbodypodcast/feed.xmlpodcastindex.org
Real Talk with Tina and AnnAnn Kagarise211October 28, 2026Weeklyrealtalktinaann.comhttps://rss.buzzsprout.com/2123315.rsspodcastindex.org
I Care About YouJuliana Jay211October 29, 2026Weeklyjulianajbruno.comhttps://feeds.alitu.com/29045299podcastindex.org
Keep Going Podcast: Athletes Shining a Light on Mental HealthKeep Going Podcast211October 26, 2026Weeklypodcasters.spotify.com/pod/show/keepgoingpodcasthttps://anchor.fm/s/cc4e55a8/podcast/rsspodcastindex.org
BDA Baby (Before, During and After Baby)Audioboom211October 29, 2026Weeklyaudioboom.com/channels/5130818https://audioboom.com/channels/5130818.rsspodcastindex.org
The Joy of Transformation - Faith, Prayer, Catholic Church, Resilience, Self-ConfidenceCathy Jo Lang RN, Certified Professional Life Coach, Public Speaker, Podcast Host, Children’s Published Book Author,211October 27, 2026Weeklycathylang716.podbean.comhttps://feed.podbean.com/cathylang716/feed.xmlpodcastindex.org
The Paradox Pendulum PodcastThe Paradox Pendulum Podcast211September 21, 2026Several times a weekspreaker.com/podcast/the-paradox-pendulum-podcast--6762934https://www.spreaker.com/show/6762934/episodes/feedpodcastindex.org
The Wellness Rhythm ShowVoxCrea.AI211October 30, 2026Several times a weekbuzzsprout.com/2563960https://rss.buzzsprout.com/2563960.rsspodcastindex.org
Elite Audiobookselite audiobooks211October 31, 2026Dailyspreaker.com/podcast/elite-audiobooks--6927130https://www.spreaker.com/show/6927130/episodes/feedpodcastindex.org
The Whole Lotta Gay ShowThe Black Effect Podcast Network and iHeartPodcasts211October 27, 2026Weeklyiheart.com/podcast/1119-the-no-homo-show-339543282https://feeds.redcircle.com/397578f9-87ec-47a1-927d-6669be2f1700podcastindex.org
Becoming MindStrongMindStrong Fitness210October 9, 2026Every two weeksmindstrongfitness.comhttps://rss.buzzsprout.com/977851.rsspodcastindex.org
EM Pulse Podcast™UC Davis Department of Emergency Medicine210October 23, 2026Every two weeksucdavisem.com/em-pulsehttps://ucdavisem.com/feed/podcast/podcastindex.org
A Shot in the Arm PodcastBen Plumley210October 30, 2026Every two weeksyoutube.com/@shotarmpodcasthttps://feeds.megaphone.fm/shot-in-the-armpodcastindex.org
Stress Management + Resilience Tools for Your Happified LifeSusi Vine210October 29, 2026Every two weekshappified.simplecast.comhttps://feeds.simplecast.com/9dn8dkodpodcastindex.org
The Manifesting LatinaNorma Reyes, PhD.210October 4, 2026Every two weeksthemanifestinglatina.com/podcasthttps://feeds.simplecast.com/CpdwzkLXpodcastindex.org
Wellness CuratedAnshu Bahanda210August 20, 2026Every two weekswellnesscurated.lifehttps://rss.buzzsprout.com/2129983.rsspodcastindex.org
The Work of Being HumanVanessa Bentley210October 19, 2026Every two weeksvanessabentley.cohttps://anchor.fm/s/4678f7e4/podcast/rsspodcastindex.org
HEAL with KellyHEAL Media210October 29, 2026Every two weekshealwithkelly.cohttps://feeds.megaphone.fm/healpodcastpodcastindex.org
The Alchemist's LibraryRyan Ayala210October 20, 2026Weeklyalchemistslibrary.buzzsprout.comhttps://rss.buzzsprout.com/1966570.rsspodcastindex.org
Too Human with Nurse NellDanelle210October 27, 2026Every two weekslinktr.ee/Nursenellhttps://anchor.fm/s/7d7e41e0/podcast/rsspodcastindex.org
Choose to Live FREE! with Kate A. Coker-DaisieKate A. Coker-Daisie210September 21, 2026Weeklyredcircle.com/shows/choose-to-live-free-with-kate-a-coker-daisiehttps://feeds.redcircle.com/74126b70-caf9-44bf-aa29-6171d29cc41fpodcastindex.org
The Funny Thing About YogaGiana Gambino210October 26, 2026Weeklycayayogaschool.com/podcastpodcastindex.org
The Whole Lotta Gay ShowThe Black Effect Podcast Network and iHeartPodcasts210October 20, 2026Weeklyiheart.com/podcast/1119-the-no-homo-show-339543282https://www.omnycontent.com/d/playlist/e73c998e-6e60-432f-8610-ae210140c5b1/76bd4b12-f642-4db2-8b19-b481010be273/a3d45335-6510-4ebd-9802-b481010be289/podcast.rsspodcastindex.org
Binaural Beats Meditation for SleepSya Warfield210October 5, 2026Weeklylinktr.ee/relaxconnectcreatehttps://media.rss.com/the-binaural-beat-podcast/feed.xmlpodcastindex.org
The Men of the House PodcastRichard Craft210October 30, 2026Weeklythemenofthehousepodcast.buzzsprout.comhttps://rss.buzzsprout.com/2359063.rsspodcastindex.org
Knight FitEmily Knight210October 26, 2026Weeklylinktr.ee/knight__fithttps://rss.buzzsprout.com/2538484.rsspodcastindex.org
Significant Coaching with Matt RogersMatt Rogers210October 30, 2026Weeklycoachmattrogers.comhttps://rss.buzzsprout.com/2375026.rsspodcastindex.org
Far From Perfect with Kylie LarsonKylie Larson209October 28, 2026Every two weeksthekylielarson.comhttps://anchor.fm/s/1354fe94/podcast/rsspodcastindex.org
The Overwatch Collective PodcastThe Overwatch Collective209October 30, 2026Every two weekstheoverwatchcollective.comhttps://rss.buzzsprout.com/1794686.rsspodcastindex.org
The Insiders' PodcastMatthew Hayes & Darren Broadbridge209October 15, 2026Every two weeksthe-insiders-podcast.buzzsprout.comhttps://rss.buzzsprout.com/1924260.rsspodcastindex.org
Living Your GreatnessBen Mumme209October 13, 2026Every two weekslivingyourgreatness.libsyn.comhttps://livingyourgreatness.libsyn.com/rsspodcastindex.org
The Bold LoungeLeigh Burgess209October 29, 2026Weeklytheboldlounge.buzzsprout.comhttps://rss.buzzsprout.com/1995306.rsspodcastindex.org
Breathingspace- Meditation for Sleep and RelaxationBreathing Space209October 25, 2026Weeklybreathingspaceasmr.wixsite.com/breathingspace-asmrpodcastindex.org
Adaptive OutdoorsmanShawn Jordan209October 31, 2026Every two weekslinktr.ee/adaptive_outdoorsmanhttps://feeds.megaphone.fm/WPCM8793377076podcastindex.org
Anger Secrets: Anger Management for Healthier RelationshipsAlastair Duhs | Anger Management Expert209October 24, 2026Weeklyangersecrets.captivate.fmhttps://feeds.captivate.fm/angersecrets/podcastindex.org
The Reverse Aging Club with Meredith OkeThe Reverse Aging Club209October 29, 2026Weeklyreverseaging.clubhttps://feeds.captivate.fm/the-reverse-aging-club/podcastindex.org
Growth, Grace, and GratitudeGrowth, Grace, and Gratitude209October 28, 2026Weeklyblueblisscoach.wixsite.com/websitehttps://anchor.fm/s/ecb11fd8/podcast/rsspodcastindex.org
Decoding HealthDr. Urban A. Kiernan209October 26, 2026Weeklydecodinghealthpocast.comhttps://rss.buzzsprout.com/2332406.rsspodcastindex.org
Runnah: Running Cape Cod, Massachusetts, and Beyond!Julianna Coughlin with The Falmouth Running Club and Falmouth Community TV209October 31, 2026Weeklypodcasters.spotify.com/pod/show/into-the-fold-a-shadow-anhttps://anchor.fm/s/fad90954/podcast/rsspodcastindex.org
The Exploration of Wonder ~ Donnielle CarterInspired Choices Network209October 19, 2026Monthlyspreaker.com/podcast/the-exploration-of-wonder-donnielle-carter--6480545https://www.spreaker.com/show/6480545/episodes/feedpodcastindex.org
The School of Greatness en EspañolLewis Howes209October 30, 2026Several times a weeklewishowes.comhttps://feeds.megaphone.fm/sogespanolpodcastindex.org
Simplify Your LifeCoach Simona208October 7, 2026Every two weekscoachsimona.comhttps://coachsimona.libsyn.com/rsspodcastindex.org
Decide Your LegacyDecide Your Legacy, LLC208October 27, 2026Every two weeksdecideyourlegacy.comhttps://feeds.transistor.fm/decide-your-legacypodcastindex.org
The life of a Third Culture Kid therapistDr Rachel Cason208October 30, 2026Every two weeksexplorelifestory.compodcastindex.org
Can Do MS PodcastCan Do Multiple Sclerosis208October 28, 2026Every two weekscando-ms.blubrry.nethttps://cando-ms.blubrry.net/feed/podcast/podcastindex.org
Recovery TalksRecovery Talks208October 27, 2026Monthlymtpeernetwork.orghttps://feeds.soundcloud.com/users/soundcloud:users:331050585/sounds.rsspodcastindex.org
BioTalk with Rich BendisBioHealth Innovation, Inc. (BHI)208October 11, 2026Every two weeksbiohealthinnovation.orghttps://biotalkbendis.libsyn.com/rsspodcastindex.org
DBT and MeDBT and Me208October 12, 2026Every two weekspatreon.com/collection/2131446podcastindex.org
The HuntavoreNick Otto208October 29, 2026Every two weekshuntavore.comhttps://feeds.simplecast.com/xhBDcSknpodcastindex.org
Chart Your CareerHeidi Rose Robbins and Ellen Fondiler208October 1, 2026Every two weeksinstagram.com/chartyourcareerpodcasthttps://chartyourcareer.libsyn.com/rsspodcastindex.org
Elisha's Space: Counseling and Authentic Conversations on HealingElisha Lee, Counseling Expert | Authentic Conversations Host208October 6, 2026Every two weekselishas-space.onpodium.cohttps://api.riverside.fm/hosting/T5RR6OI0.rsspodcastindex.org
Conquer The Clutter Podcast with Elaine BirchallElaine Birchall208August 26, 2026Every two weekselainebirchallpodcasts.buzzsprout.comhttps://rss.buzzsprout.com/1894343.rsspodcastindex.org
Healthtech PigeonJames Somauroo208October 25, 2026Weeklyhealthtechpigeon.comhttps://feeds.transistor.fm/healthtech-pigeonpodcastindex.org
UnabridgedMDIsabelle Amigues, MD208October 28, 2026Weeklybuzzsprout.com/2023422https://rss.buzzsprout.com/2023422.rsspodcastindex.org
Unhooked: Breaking Porn Addiction PodcastJeremy Lipkowitz208October 26, 2026Weeklyunhooked.buzzsprout.comhttps://rss.buzzsprout.com/2017004.rsspodcastindex.org
Master Your Relationship Mind DramaRebecca Ore208October 30, 2026Weeklyrebeccaorecoaching.comhttps://rss.buzzsprout.com/2028082.rsspodcastindex.org
The Dr. Francavilla ShowDr. Francavilla208October 26, 2026Weeklybuzzsprout.com/2079861https://rss.buzzsprout.com/2079861.rsspodcastindex.org
With You in the Weeds: Where Faith Meets Mental HealthWith You in the Weeds208October 28, 2026Weeklywithyouintheweeds.comhttps://feeds.megaphone.fm/EPC5113723950podcastindex.org
Weight Loss for FertilityStephanie Fein, MD208October 27, 2026Weeklystephaniefeinmd.com/podcasts/weight-loss-for-fertilityhttps://app.kajabi.com/podcasts/2147507915/feedpodcastindex.org
Binge Eating BreakthroughJane Pilger208October 28, 2026Weeklyjanepilger.com/podcasthttps://rss.buzzsprout.com/2069013.rsspodcastindex.org
Michael Hicks The Liv2thrive PodcastMichael Hicks208October 28, 2026Weeklyframingnewheights.comhttps://rss.buzzsprout.com/2063810.rsspodcastindex.org
Healing After Hours with ShaniquaShaniqua Smith208October 28, 2026Weeklylinktr.ee/ProphetessShaniquahttps://rss.buzzsprout.com/2272485.rsspodcastindex.org
Sex Stories 🔥Audiodesires208October 19, 2026Weeklyaudiodesires.comhttps://podcasts-host.nyc3.digitaloceanspaces.com/rss/podcast-en-28-sex-stories.rsspodcastindex.org
The Everyday Health StruggleOkechukwu Okoro208October 28, 2026Dailypodcasters.spotify.com/pod/show/okechukwu-okoro0https://anchor.fm/s/11139017c/podcast/rsspodcastindex.org
Straight Talk - Mind and Muscle PodcastDamian Porter207October 25, 2026Every two weekspodcasts.podtoo.com/kNQcFjrKhttps://feed.podtoo.com/kNQcFjrKpodcastindex.org
Rockstar Doctor Life| Chiropractic Life & PracticeDr. Melissa Longo207September 10, 2026Monthlyrockstardoctorlife.comhttps://rockstardoctormoms.libsyn.com/rsspodcastindex.org
ChiroFEAST: THE Podcast for Chiropractors and EntrepreneursDr. Jeff Danielson | Doctor of Chiropractic207October 27, 2026Every two weeksmybigfishenterprises.comhttps://rss.buzzsprout.com/799865.rsspodcastindex.org
This Teenage LifeMolly Josephs207August 20, 2026Every two weeksthisteenagelife.orghttps://thisteenlife.libsyn.com/rsspodcastindex.org
Free Podcasts | Indoor Cycle Instructor Podcast | ICI/PRO Premium EducationJohn Macgowan207August 22, 2026Monthlyindoorcycleinstructor.comhttp://feeds.feedburner.com/IndoorCycleFreePodcastpodcastindex.org
The Dr. Raj PodcastWooden Nickel Ventures, LLC207October 31, 2026Every two weeksmedpreptogo.comhttps://feeds.megaphone.fm/FPMN1077425037podcastindex.org
South Texas Judo 360 PodcastJerry Koch207October 11, 2026Every two weeksattacktheattack360.comhttps://rss.buzzsprout.com/1858699.rsspodcastindex.org
Advanced Biblical FoundationsTerry Moore207October 7, 2026Weeklyjterrymoore.orghttps://feeds.captivate.fm/advanced-foundations/podcastindex.org
Trensparent with Nyle NaygaNyle Nayga207October 26, 2026Weeklyyoutube.com/channel/UCqgN2kieCEHwZ9M-QFBxfCg/abouthttps://rss.buzzsprout.com/2043438.rsspodcastindex.org
Chosen FamilyChosen Family & Studio71207October 28, 2026Weeklystudio71.com/us/podcastshttps://feeds.megaphone.fm/chosenfamilypodcastpodcastindex.org
MusclesMascaraMotherhoodDamilola Bode-Ogundipe207October 15, 2026Weeklybuzzsprout.com/2170885https://rss.buzzsprout.com/2170885.rsspodcastindex.org
Cycling Demystified - The Art, Craft & People Behind Bike FitCycling Demystified207October 25, 2026Weeklypodcasters.spotify.com/pod/show/cycling-demystifiedhttps://anchor.fm/s/e60327e4/podcast/rsspodcastindex.org
Erotic Audio Stories by Audiodesires (Erotic Audio)Audiodesires207October 22, 2026Weeklyaudiodesires.comhttps://podcasts-host.nyc3.digitaloceanspaces.com/rss/podcast-en-26-erotic-audio-by-audiodesires.rsspodcastindex.org
Sounds SouthernAlice Pierotti207October 27, 2026Weeklysoundssouthern.compodcastindex.org
Sexy StoriesSarah Lust207October 31, 2026Dailysexystories.supercast.comhttps://www.spreaker.com/show/6840108/episodes/feedpodcastindex.org
Deep Sleep Tibetan Singing Bowls SoundsJosh Linsk207September 3, 2026Dailydeepsleeppodcasts.comhttps://feeds.megaphone.fm/deep-sleep-tibetan-singing-bowls-soundspodcastindex.org
Relax With Animal FactsStefan Wolfe207August 16, 2026Every two weeksrelaxwithanimalfacts.comhttps://feed.ausha.co/DZk2MIwx1KM0podcastindex.org
Clinical Journal of the American Society of Nephrology (CJASN)Hal Nesbitt206October 30, 2026Monthlycjasn.asnjournals.orghttps://www.asn-online.org/media/podcast/feed.aspx?p=CJASNpodcastindex.org
Living Well with Robin StoloffRobin Stoloff206October 20, 2026Every two weekslivingwellwithrobinstoloff.podbean.comhttps://feed.podbean.com/livingwellwithrobinstoloff/feed.xmlpodcastindex.org
with intention from CassandraCassandra Bodzak206August 12, 2026Monthlycassandrabodzak.comhttps://feeds.simplecast.com/3kH_f64Dpodcastindex.org
The Alan Williams PodcastAlan Williams Coaching206September 15, 2026Every two weekspodcasters.spotify.com/pod/show/alanwilliamshttps://anchor.fm/s/a1b41e4/podcast/rsspodcastindex.org
The OCD Whisperer Podcast with Kristina OrlovaKristina Orlova206October 31, 2026Every two weeksocdwhisperer.podbean.comhttps://feedcdn.podbean.com/ocdwhisperer/feed.xmlpodcastindex.org
True BirthMaternal Resources206October 6, 2026Every two weekstruebirth.libsyn.com/websitehttps://truebirth.libsyn.com/rsspodcastindex.org
Fearless PracticeJules Smith206October 28, 2026Every two weeksfearlesspractice.cahttps://fearlesspractice.libsyn.com/rsspodcastindex.org
The Ultimate Pregnancy Prep PodcastNora DeBora206October 25, 2026Every two weekssites.libsyn.com/398336https://feeds.libsyn.com/398336/rsspodcastindex.org
Brown Noise Sleep SoundsBrown Noise Sleep Sounds206August 25, 2026Weeklybrownnoisesleepsounds.comhttps://anchor.fm/s/9cd66f54/podcast/rsspodcastindex.org
ALIGNED & ALIVE with Chrissy MayChrissy May206October 11, 2026Weeklychrissymay.comhttps://rss.buzzsprout.com/1970688.rsspodcastindex.org
The Maybird Cycling PodcastJoe Draper206October 22, 2026Weeklyrss.com/podcasts/themaybirdcyclingpodcasthttps://media.rss.com/themaybirdcyclingpodcast/feed.xmlpodcastindex.org
Busy, Yet PrettyJadyn Hailey206October 26, 2026Every two weeksart19.com/shows/busy-yet-prettyhttps://rss.art19.com/busy-yet-prettypodcastindex.org
Living A Full LifeFull Life Chiropractic206October 27, 2026Weeklylivingafulllife.buzzsprout.comhttps://rss.buzzsprout.com/2079037.rsspodcastindex.org
SelfCareSchool's Spam Filter for Your BrainAnna HeardinLondon206October 29, 2026Weeklyselfcareschool.co.ukhttps://anchor.fm/s/bd511874/podcast/rsspodcastindex.org
Untapped PodcastUntapped Podcast206October 26, 2026Every two weekspodcasters.spotify.com/pod/show/extrication-fitnesshttps://anchor.fm/s/74cbc310/podcast/rsspodcastindex.org
Nutrition Prescription: Wellness vs MedicationsDr. Steve Hughlett206October 26, 2026Weeklydrstevehughlett.comhttps://feeds.libsyn.com/431169/rsspodcastindex.org
Nurture HerselfAmanda206October 26, 2026Weeklybuzzsprout.com/2239348https://rss.buzzsprout.com/2239348.rsspodcastindex.org
The Martial Arts Lifestyle PodcastTim Becherer206October 26, 2026Weeklybuzzsprout.com/2295689https://rss.buzzsprout.com/2295689.rsspodcastindex.org
Bye Bye PanicShaan Kassam206October 26, 2026Weeklyredcircle.com/shows/bye-bye-panichttps://feeds.redcircle.com/95c0f98e-beb2-4f0f-92be-a5c744e44929podcastindex.org
Harnessing Happiness with Sarah J NaylorSarah J Naylor206August 25, 2026Every two weeksharnessinghappiness.transistor.fmhttps://feeds.transistor.fm/harnessing-happiness-with-sarah-j-naylorpodcastindex.org

Next 500 shows

Updated November 3, 2026. Read from Podcast Index. Free for any use (the Podcast Index public database). Episode counts and dates are as each show's feed reports them to the Podcast Index. How often a show publishes is the average gap between its first and its latest episode. The index keeps at most 1,000 episodes of a show. Owner names are printed as the feed prints them. Contact addresses are not shown here. Free to reuse with credit to SpecStream under CC BY 4.0. Spot a wrong value? Write to [email protected] with the link to this page.