Skip to the page
Get started free

Data / Podcasts / Health / English

Health podcasts in English: 28,624 active shows (2026), page 14

28,624 health podcasts in English published an episode in the last 90 days to October 31, 2026. 9,950 publish at least weekly and 7,177 published in the last 7 days. The list gives each show's owner, episode count, last episode, publishing frequency, website and feed, read from the Podcast Index on November 3, 2026.

SpecStream is the live web data engine for teams and agents. It reads the Podcast Index every day, and this page is that reading. Ask for the shows you want by topic, language and how often they publish, with each show's contact, and new and changed shows arrive in your sheet, CRM, Slack or agent.

Get health podcasts in EnglishWatch for new shows

Active health podcasts in English, 6,501 to 7,000

ShowOwnerEpisodesLast episodePublishesWebsiteFeedSource
The CatalystChris Cooper145October 17, 2026Every two weekscatalystgym.comhttps://feeds.captivate.fm/thecatalystmethod/podcastindex.org
The Just A Mom PodcastSusie Gurley145October 27, 2026Every two weeksthejustamompodcast.comhttps://feeds.transistor.fm/the-just-a-mom-podcastpodcastindex.org
Forum Health Integrative Medicine PodcastForum Health145October 27, 2026Every two weeksforumhealth.comhttps://anchor.fm/s/10b000c9c/podcast/rsspodcastindex.org
Healing The Source PodcastClaudia Briare145October 28, 2026Every two weekshealingthesource.cohttps://feeds.libsyn.com/451539/rsspodcastindex.org
feelgooderyKyle Buchanan145October 22, 2026Every two weeksbuzzsprout.com/2142610https://rss.buzzsprout.com/2142610.rsspodcastindex.org
THE DCA PodcastDidi Ferrari145October 26, 2026Every two weekscoachedbydidi.co.uk/podcasts/the-dca-podcasthttps://app.kajabi.com/podcasts/2147496425/feedpodcastindex.org
Dr Julie's Coffee ChatsDr Julie145October 27, 2026Every two weeksdrjulie.co.nzhttps://rss.buzzsprout.com/2209347.rsspodcastindex.org
GNAC InsiderGNAC145October 30, 2026Monthlyblogtalkradio.com/gnacinsiderhttps://rss.buzzsprout.com/2230722.rsspodcastindex.org
This Is Grief Too with Laverne McKinnonLaverne McKinnon145October 26, 2026Every two weeksthisisgrieftoo.substack.com/podcastpodcastindex.org
Hack Your HappinessSmall Bits of Happiness145September 16, 2026Weeklysmallbitsofhappiness.comhttps://anchor.fm/s/e539c4d0/podcast/rsspodcastindex.org
THE DIMPLE BINDRA SHOWDimple Bindra145October 19, 2026Weeklybuzzsprout.com/2305884https://rss.buzzsprout.com/2305884.rsspodcastindex.org
Running PartnersPaul Griffiths and Alison Scope145October 18, 2026Weeklyrunning-partners.captivate.fmhttps://feeds.megaphone.fm/COMG2714123991/podcastindex.org
The Driven AthleteDr. Kyle Volstad, PT, DPT, OCS, FAAOMPT, CSCS145October 29, 2026Weeklyathleterestorationcompany.comhttps://rss.buzzsprout.com/2253031.rsspodcastindex.org
Reflective Hour with Tammy Toney-ButlerTammy Toney-Butler145October 27, 2026Weeklyreflectivespacesministry.comhttps://rss.buzzsprout.com/2255846.rsspodcastindex.org
Truth in CoachingJoshua Spencer145October 2, 2026Weeklyshows.acast.com/truth-in-coachingpodcastindex.org
Gettin Real with Cockney BuddhaCockney Buddha145October 30, 2026Weeklymindnutrition4all.comhttps://rss.buzzsprout.com/2286205.rsspodcastindex.org
Beyond DiagnosisRita De Michele145October 15, 2026Weeklybeyonddiagnosis.buzzsprout.comhttps://rss.buzzsprout.com/1792698.rsspodcastindex.org
Far 2 FabulousJulie Clark & Catherine Chapman145October 29, 2026Weeklyfar2fabulous.buzzsprout.comhttps://rss.buzzsprout.com/2278731.rsspodcastindex.org
Five Year YouAndrew Dewar and Catherine Collins145October 28, 2026Weeklyfiveyearyou.com/podcasthttps://feeds.captivate.fm/five-year-you/podcastindex.org
Pleasure Uprising: Desire, Attachment, and the Sex You Actually WantLaura Jurgens, Ph.D.145October 26, 2026Weeklylaurajurgens.com/podcasthttps://rss.buzzsprout.com/2303792.rsspodcastindex.org
Lead Well! with Christine SchickingerChristine Schickinger145October 20, 2026Weeklychristine-schickinger.comhttps://lead-well-podcast.podigee.io/feed/mp3podcastindex.org
Everyday Epigenetics: Raw. Real. Relatable.Susan Robbins145October 19, 2026Weeklyeverydayepigenetics.buzzsprout.comhttps://rss.buzzsprout.com/2328546.rsspodcastindex.org
the strong women collective podcastHarriet Buttigieg145October 22, 2026Weeklypodcasters.spotify.com/pod/show/harriet-buttigieghttps://anchor.fm/s/f3de03fc/podcast/rsspodcastindex.org
StRest with Kerstin LindquistKerstin Lindquist145October 27, 2026Weeklykerstin-lindquist.comhttps://feeds.megaphone.fm/TGL6397982646podcastindex.org
Blue Chip Athletic Club by Blaise CurtisBlaise Curtis145October 23, 2026Weeklybluechipathleticclub.comhttps://api.riverside.fm/hosting/nrPWTa5B.rsspodcastindex.org
Spiritual Sanctuary: Wisdom for the Divine FeminineBertena, Priestess145October 27, 2026Every two weeksbertena.orghttps://feeds.captivate.fm/spiritual-sanctuary/podcastindex.org
OptiCast - The Optimization Lab PodcastThe Optimization Lab145October 30, 2026Dailybuzzsprout.com/2610091https://rss.buzzsprout.com/2610091.rsspodcastindex.org
Demystifying Gay PornI. Que Grande144September 17, 2026Monthlydemystifyinggayporn.buzzsprout.comhttps://rss.buzzsprout.com/450796.rsspodcastindex.org
JAMA Psychiatry Author InterviewsAmerican Medical Association144October 14, 2026Monthlyjamanetwork.com/journals/jamapsychiatryhttps://jamapsychiatryauthorinterviews.libsyn.com/rsspodcastindex.org
Unstoppable With Shangrila RendonShangrila Rendon144October 29, 2026Monthlyfeistyfoxfire.podbean.comhttps://feed.podbean.com/feistyfoxfire/feed.xmlpodcastindex.org
Common Ground RadioWERU-FM144September 10, 2026Monthlyarchives.weru.org/category/common-ground-radiohttp://feeds.feedburner.com/CommonGroundRadiopodcastindex.org
BreakpointsSociety of Infectious Diseases Pharmacists144October 23, 2026Monthlysidp.pinecast.cohttps://pinecast.com/feed/sidppodcastindex.org
Coffee with The Couple CureJay & Lori Pyatt144October 22, 2026Monthlythecouplecure.com/blog-podcasthttps://thecouplecure.com/feed/podcast/podcastindex.org
D&M's with DEANDean Lucas144September 13, 2026Monthlyan-off-track-experience.zencast.websitepodcastindex.org
Living At Your FinestDR.BABS144September 30, 2026Every two weekslivingatyourfinest.comhttps://rss.buzzsprout.com/1202669.rsspodcastindex.org
Cowboys not EggheadsSam Fischer144September 11, 2026Every two weeksbuzzsprout.com/1538482https://rss.buzzsprout.com/1538482.rsspodcastindex.org
Dreams Around The WorldDan144September 25, 2026Every two weeksdreamsaroundtheworld.comhttps://www.spreaker.com/show/2218653/episodes/feedpodcastindex.org
Nurturing Words: Voices of ExperienceMotherless Daughters Ministry144October 9, 2026Every two weeksmotherlessdaughtersministry.comhttps://rss.buzzsprout.com/1040194.rsspodcastindex.org
Owning Pleasure As A Black WomanNatasha Riley144October 30, 2026Every two weeksjaverywellness.comhttps://feeds.captivate.fm/owning-pleasure-as-a-bl/podcastindex.org
Living While Loving Your Child Through AddictionHeather Ross144October 14, 2026Every two weeksheatherrosscoaching.comhttps://anchor.fm/s/3ea864a0/podcast/rsspodcastindex.org
Elevate with EricaErica Renee144October 12, 2026Every two weeksinstagram.com/ms_erica_reneehttps://rss.buzzsprout.com/1705909.rsspodcastindex.org
Bodies Behind The BusBodies Behind The Bus144October 30, 2026Every two weekssacredwilderness.org/bodiesbehindthebusshttps://rss.buzzsprout.com/1906938.rsspodcastindex.org
Sirens, Slammers and Service - A podcast for Female First RespondersNikki Cloutier144September 18, 2026Every two weekssirensslammersandserviceapodcastforfemalefirstresponders.buzzsprout.comhttps://rss.buzzsprout.com/2026034.rsspodcastindex.org
Kingdom Mothers Rise UpMukkove - The Mom Mentor144September 22, 2026Every two weeksmukkovejohnson.comhttps://rss.buzzsprout.com/1999324.rsspodcastindex.org
The Dark StudioBrandon Richey144October 27, 2026Every two weeksbrandonrichey.substack.com/podcastpodcastindex.org
Focus and Chill - productivity tactics for AuDHDers and other neurodivergent folksFocus Bear Pty Ltd144October 11, 2026Every two weekspodcast.focusbear.iohttps://feeds.transistor.fm/focus-and-chillpodcastindex.org
Eat Like RubyRuby Fraser144October 26, 2026Several times a weekbuzzsprout.com/2311219https://rss.buzzsprout.com/2311219.rsspodcastindex.org
Inside Athletic TrainingThe Professional Baseball Athletic Trainers Society144October 30, 2026Every two weekspbats.comhttps://rss.buzzsprout.com/2112084.rsspodcastindex.org
The Shameless RomanticKat Wilhoit144October 21, 2026Every two weekstheshamelessromantic.buzzsprout.comhttps://rss.buzzsprout.com/2064287.rsspodcastindex.org
Beyond the PillsJosh Rimany144October 27, 2026Every two weeksbeyond-the-pills.captivate.fmhttps://feeds.captivate.fm/beyond-the-pills/podcastindex.org
Learn to Thrive with ADHD PodcastMande John144October 29, 2026Every two weekslearntothrivewithadhd.comhttps://rss.buzzsprout.com/1954263.rsspodcastindex.org
Making It AwkwardJessica Wilson, MS RD144October 22, 2026Every two weekspatreon.com/MakingItAwkwardhttps://rss.libsyn.com/shows/600200/destinations/5222235.xmlpodcastindex.org
Rising From ShameMind Body Spirit.fm144October 2, 2026Weeklymindbodyspirit.fm/shows/rising-from-shamehttps://feeds.megaphone.fm/nadiadavishomeiswithinyoupodcastindex.org
Soul AwakeningJoy Truscott144August 13, 2026Weeklyjoytruscott.comhttps://rss.buzzsprout.com/2252456.rsspodcastindex.org
Live Parkinson's - Live an Exceptional Life!Chris144September 25, 2026Weeklybuzzsprout.com/2255986https://rss.buzzsprout.com/2255986.rsspodcastindex.org
Radical Remission Project ”Stories That Heal” PodcastRadical Remission Project144October 28, 2026Weeklyradicalremissionpodcast.podbean.comhttps://feed.podbean.com/radicalremissionpodcast/feed.xmlpodcastindex.org
Mums F**king MatterLucy Wylde144October 27, 2026Weeklymums-fking-matter.captivate.fmhttps://feeds.captivate.fm/mums-fking-matter/podcastindex.org
Fertility, Pregnancy, & Period Tips: Hormone Health ClassVanda, Fertility & Hormone Nurse + Functional Practitioner144October 27, 2026Weeklyhormonehealthclass.buzzsprout.comhttps://rss.buzzsprout.com/2214197.rsspodcastindex.org
Living ClarityKadampa Buddhism144October 26, 2026Weeklykadampa.orghttps://feeds.castos.com/v4d15podcastindex.org
Care Talk with Laura Packard: American Health Care ExplainedLaura Packard144September 22, 2026Every two weeksredcircle.com/shows/care-talk-with-laura-packardhttps://feeds.redcircle.com/f4520de0-f5b9-4ba9-b510-a517553cf327podcastindex.org
Speak Honest Podcast: Real Talk on Relationships, Attachment Styles & the Work of Healing Childhood TraumaJennifer Noble, PCC | Relationship Coach, TEDx Speaker, & Best Selling Author144October 28, 2026Weeklyspeak-honest.comhttps://rss.buzzsprout.com/2253591.rsspodcastindex.org
Next Level Play Therapy: A Podcast for Play Therapy ExcellenceCathi Spooner, LCSW, RPT-S144October 29, 2026Weeklyrhplaytherapytraining.comhttps://rss.buzzsprout.com/2021678.rsspodcastindex.org
A Cup of Dri: Fitness Thoughts from My Car to YoursAdriana Mastronardi144October 28, 2026Weeklypodcasters.spotify.com/pod/show/acupofdrihttps://api.riverside.com/hosting/ZPZqJ7EK.rsspodcastindex.org
CannaFitness and Nutrition PodcastBeth Skinner Jasinski144October 28, 2026Weeklycannafitnessnutrition.comhttps://anchor.fm/s/ec0b1dcc/podcast/rsspodcastindex.org
Pour Out Your JoyBethany and Carol144October 27, 2026Weeklypouroutyourjoy.buzzsprout.comhttps://rss.buzzsprout.com/2252348.rsspodcastindex.org
The Valiant ForgeMark Osborne144October 31, 2026Weeklythevaliantforge.comhttps://feeds.captivate.fm/the-valiant-forge/podcastindex.org
Endoscopy EssentialsThomas Rösch144October 30, 2026Weeklyendoscopy-essentials.comhttps://anchor.fm/s/f79c9b34/podcast/rsspodcastindex.org
The Functional Code PodcastDr. Jace Nybo, Dr. Addy Knutson144October 28, 2026Weeklypodcasters.spotify.com/pod/show/the-functional-code-podcahttps://anchor.fm/s/f147e02c/podcast/rsspodcastindex.org
Mind Set in Stone PodcastBig L Riz144October 26, 2026Weeklybiglrizmedia.comhttps://rss.buzzsprout.com/2419636.rsspodcastindex.org
The Intimacy InquiryAndrew Phipps144October 21, 2026Weeklyrss.com/podcasts/the-intimacy-inquiryhttps://media.rss.com/the-intimacy-inquiry/feed.xmlpodcastindex.org
PCOS Unfiltered: Nourish, Heal, ThriveLindsie Vizethann144October 30, 2026Weeklypcos-unfiltered-nourish-heal-thrive.simplecast.comhttps://feeds.simplecast.com/PvQuCz0wpodcastindex.org
The Other Side of AddictionAl Richards144October 20, 2026Several times a weekredcircle.com/shows/the-other-side-of-addictionhttps://feeds.redcircle.com/e4372363-4211-467d-8e1c-35f0330f6168podcastindex.org
WhispersoftBret Wellman144October 29, 2026Several times a weekpodcasters.spotify.com/pod/show/bret-wellmanhttps://anchor.fm/s/10e010e3c/podcast/rsspodcastindex.org
Dr Sam RobbinsDr Sam Robbins144October 31, 2026All episodes at oncehttps://feeds.megaphone.fm/dr-sam-robbinspodcastindex.org
The Dietitian CafeNualtra143October 28, 2026Monthlynualtra.comhttps://rss.buzzsprout.com/2414030.rsspodcastindex.org
Healing At The Edge with RamDev Dale BorglumBe Here Now Network143October 21, 2026Monthlyart19.com/shows/dale-borglum-with-healing-at-the-edgehttps://rss.art19.com/dale-borglum-with-healing-at-the-edgepodcastindex.org
The NeuFit Undercurrent PodcastGarrett Salpeter143October 23, 2026Monthlyneu.fit/podcasthttps://undercurrent.libsyn.com/rsspodcastindex.org
Mindset Is ArtCJ Ledy143October 26, 2026Every two weekscjledy.comhttps://rss.buzzsprout.com/1772182.rsspodcastindex.org
The ADHD Clarity Coach: ADHD Crash CourseDonae Cannon143October 21, 2026Every two weekstheadhdclaritycoach.comhttps://rss.buzzsprout.com/1833238.rsspodcastindex.org
Right Your Own StoryJames Taylor143October 10, 2026Every two weeksrightyourownstory.co.ukhttps://anchor.fm/s/6c502578/podcast/rsspodcastindex.org
The 5:32am Podcast.Ryan Stirton143October 26, 2026Every two weeksinstagram.com/ryan_stirtonpthttps://feeds.transistor.fm/the-rls-podcastpodcastindex.org
She ShieldSofia Espina143September 21, 2026Every two weekssheshieldpodcast.buzzsprout.comhttps://rss.buzzsprout.com/1895818.rsspodcastindex.org
Goaliath: Achieve your ultimate goals with meSean Lynch143October 10, 2026Every two weeksbuzzsprout.com/1921878https://rss.buzzsprout.com/1921878.rsspodcastindex.org
The Tequila HourAmanda Jeffrey143October 18, 2026Every two weeksthetequilahour.buzzsprout.comhttps://rss.buzzsprout.com/1928778.rsspodcastindex.org
Man UpDr. Kevin Chu and Dr. Justin Dubin143October 26, 2026Every two weeksthemanuppod.comhttps://anchor.fm/s/6707a8c0/podcast/rsspodcastindex.org
Becca BabblesBecca143October 19, 2026Every two weeksredcircle.com/shows/becca-babbles-podcasthttps://feeds.redcircle.com/81463372-aed6-46df-b3a6-ea1d810a35ffpodcastindex.org
Balance and BarbellsKayla Durck143October 9, 2026Every two weekskayladurck.comhttps://rss.buzzsprout.com/2054882.rsspodcastindex.org
ReThreading MadnessBernadine Fox143October 27, 2026Every two weeksrethreadingmadness.cahttps://www.spreaker.com/show/5675300/episodes/feedpodcastindex.org
Formed by Jesus PodcastPassion Creek Church143October 27, 2026Every two weeksformed-by-jesus-podcast.simplecast.comhttps://feeds.simplecast.com/HK8OHLqgpodcastindex.org
The EZ Struggle PodcastZAZ143October 27, 2026Every two weeksrss.com/podcasts/the-ez-strugglehttps://media.rss.com/the-ez-struggle/feed.xmlpodcastindex.org
Think DementiaAmy House C.D.P.143October 25, 2026Every two weeksthinkdementia.buzzsprout.comhttps://rss.buzzsprout.com/2170330.rsspodcastindex.org
Women's Wellness with Abbe FederCloud10143October 30, 2026Every two weekshttps://feeds.megaphone.fm/CTL1911597084podcastindex.org
Jayce Reads RomanceJayce143October 23, 2026Weeklyjaycereadsromance.com/podcasthttps://jaycereadsromance.squarespace.com/podcast?format=rsspodcastindex.org
The Body PodHailey Happens Fitness + Love By Laura143October 29, 2026Weeklyspreaker.com/podcast/the-body-pod--6344619https://www.spreaker.com/show/6344619/episodes/feedpodcastindex.org
Degrees of HealthBenjamin Hopkins143October 30, 2026Weeklyshows.acast.com/degreesofhealthpodcastindex.org
The Scales of WellnessKathy Bedward143October 26, 2026Weeklybuzzsprout.com/2293058https://rss.buzzsprout.com/2293058.rsspodcastindex.org
The Gaslit Truth PodcastDr. Teralyn Sell & Therapist Jenn Schmitz143October 27, 2026Weeklybuzzsprout.com/2287173https://rss.buzzsprout.com/2287173.rsspodcastindex.org
Beyond the Founder : Master Your LifeLuke Beastall143October 25, 2026Weeklymaster-your-life.co.ukhttps://rss.buzzsprout.com/2311426.rsspodcastindex.org
The Better Basics PodcastMatt Stone and Dylan Waldhuetter143October 28, 2026Weeklythebasictrainer.comhttps://anchor.fm/s/ef7e7bfc/podcast/rsspodcastindex.org
Save Yourself With Dr. Amy ShahDr. Amy Shah143October 28, 2026Weeklyamymdwellness.comhttps://feeds.megaphone.fm/ELYMN5266626860podcastindex.org
Musings and Modalities with Tristen Stawicki: Your Pragmatic Shaman BestieTristen Stawicki143October 22, 2026Weeklymusingsandmodalities.comhttps://www.spreaker.com/show/6095167/episodes/feedpodcastindex.org
Come As You Are PodcastAlly Hamilton143September 20, 2026Weeklyallyhamilton.yogisanonymous.com/podcastpodcastindex.org
Underneath the UnderneathOhmek143October 28, 2026Weeklyohmekliving.comhttps://feeds.captivate.fm/ohmek-underneath-the-underneath/podcastindex.org
Escape the ClinicKatie Bean143October 2, 2026Weeklyescape-the-clinic.captivate.fmhttps://feeds.captivate.fm/escape-the-clinic/podcastindex.org
AI in Medicine - curated summaries making complex issues easy to understandMike Rawson143October 31, 2026Weeklyai-in-medicine-podcast.vercel.apphttps://ai-in-medicine-podcast.vercel.app/feed.xmlpodcastindex.org
The Judd Lienhard PodcastJudd Lienhard143October 29, 2026Weeklyjuddlienhard.comhttps://rss.buzzsprout.com/2443113.rsspodcastindex.org
From The Ashes RadioRob , Producer Joe and The Rock143September 8, 2026Every two weeksaboutfaceradio.orghttps://anchor.fm/s/9d4065e4/podcast/rsspodcastindex.org
Peptide of the Week | Weight Loss, Health & WellnessJD Denham143October 29, 2026Weeklyspreaker.com/podcast/peptide-of-the-week--7447107https://anchor.fm/s/1058fab64/podcast/rsspodcastindex.org
Neuroscience Daily: 5-minute briefingpod pub143October 21, 2026Dailyhttps://feeds.transistor.fm/daily-neurosciencepodcastindex.org
Soulfull Sound PodcastSimone Niles142October 28, 2026Monthlysimoneniles.com/podcasts/soulfull-sound-podcasthttps://app.kajabi.com/podcasts/2147498165/feedpodcastindex.org
From the Inside Out: With Rivkah Krinsky and Eda SchottensteinRivkah and Eda142October 22, 2026Monthlyfromtheinsideout.buzzsprout.comhttps://rss.buzzsprout.com/804464.rsspodcastindex.org
Air Time Podcastjody wachniak142October 28, 2026Monthlyairtimepodcast.comhttps://airtimepodcast.libsyn.com/rsspodcastindex.org
Come Lose ItMatt Duncan142October 11, 2026Monthlycomeloseit.wordpress.comhttps://anchor.fm/s/2b270a30/podcast/rsspodcastindex.org
Kaleidoscope of PossibilitiesDr. Adriana Popescu142October 12, 2026Monthlykaleidoscopeofpossibilities.podbean.comhttps://feed.podbean.com/kaleidoscopeofpossibilities/feed.xmlpodcastindex.org
CCAirwavesThe Catholic Cemeteries Association142October 8, 2026Monthlyclecem.orghttps://rss.buzzsprout.com/814187.rsspodcastindex.org
OTR - Achieving Mental Health for RealRobert Adleman142October 20, 2026Monthlybobadleman.wixsite.com/otrmentalhealthhttps://feeds.captivate.fm/otr-achieving-mental/podcastindex.org
The Round 12 Show: MOTIVATIONAL MASTERYRoger B. Hamilton142October 18, 2026Monthlyround12resilience.podbean.comhttps://round12resilience.podbean.com/feed.xmlpodcastindex.org
Body Charge by Elektra MagnesiumDaniel142October 29, 2026Every two weeksspreaker.com/podcast/body-charge-by-elektra-magnesium--4857635https://www.spreaker.com/show/4857635/episodes/feedpodcastindex.org
Hunters HD Gold®, Behind the LensHunters HD Gold® - Brian Conley142October 28, 2026Every two weekshuntershdgold.comhttps://rss.buzzsprout.com/1808583.rsspodcastindex.org
The Vegan Beauty Power Lifestyle PodcastJessica Maria Britt142September 7, 2026Every two weeksredcircle.com/shows/the-vegan-beauty-power-lifestyle-podcasthttps://feeds.redcircle.com/885182bb-371d-4a91-8d08-c057fabac8c0podcastindex.org
Fairway Performance PodcastShaun Diachkoff142October 19, 2026Every two weeksfairwayperformance.comhttps://rss.buzzsprout.com/2017271.rsspodcastindex.org
Live Your Best MidlifeJill Lewis142October 14, 2026Every two weeksjilllewisliving.comhttps://anchor.fm/s/be22ee08/podcast/rsspodcastindex.org
What the Health Just Happened?ET Media, LLC142October 19, 2026Every two weeksrss.com/podcasts/whatthehealthjusthappenedhttps://media.rss.com/whatthehealthjusthappened/feed.xmlpodcastindex.org
The OBservations PodcastAmerican Association of Pro-Life Obstetricians and Gynecologists (AAPLOG)142October 29, 2026Every two weeksbuzzsprout.com/2171868https://rss.buzzsprout.com/2171868.rsspodcastindex.org
The Fitness 4 Back Pain PodcastWilliam Richards142August 27, 2026Every two weeksfitness4backpain.mykajabi.com/podcasts/the-fitness-4-back-pain-podcasthttps://app.kajabi.com/podcasts/2147527213/feedpodcastindex.org
In a Nutshell: The Plant-Based Health Professionals UK PodcastClare Day and Daisy Lund142October 28, 2026Every two weekspodcasters.spotify.com/pod/show/clare-day2https://anchor.fm/s/e0ec201c/podcast/rsspodcastindex.org
The Chad Franco PodcastChad Franco142October 27, 2026Every two weekspodcasters.spotify.com/pod/show/chad-francohttps://anchor.fm/s/e3e5ff2c/podcast/rsspodcastindex.org
Don't Be Caught Dead: Grief, Loss, Death Literacy and Getting PreparedHosted by Catherine Ashton, founder of Australian social enterprise Critical Info. Learn more: www.criticalinfo.com.au142October 28, 2026Weeklydontbecaughtdead.buzzsprout.comhttps://rss.buzzsprout.com/2287809.rsspodcastindex.org
Hypnotic Authenticity | Coming Home to YourselfAuthentic Life | Clinical Hypnotherapist142October 5, 2026Weeklyauthenticlifecoaching.chhttps://anchor.fm/s/f02e3010/podcast/rsspodcastindex.org
The Intelligence For Your Life Podcast with John TeshJohn Tesh142October 27, 2026Weeklypodcast.tesh.comhttps://rss.buzzsprout.com/2379393.rsspodcastindex.org
Emily the Mystic ShowEmily Logan Lewis142October 28, 2026Weeklyemilythemystic.com/podcasts/emily-the-mystic-showhttps://app.kajabi.com/podcasts/2147707657/feedpodcastindex.org
Nutrition for MamasBrooke MIller, RD, CLC142October 27, 2026Weeklythepostpartumshift.podbean.comhttps://feed.podbean.com/thepostpartumreset/feed.xmlpodcastindex.org
The Physique ForumThe Physique Forum142October 27, 2026Every two weekspodcasters.spotify.com/pod/show/thephysiqueforumhttps://anchor.fm/s/e735a4d4/podcast/rsspodcastindex.org
Ride and Laugh MTB PodcastDan & Sage142October 28, 2026Weeklyrideandlaugh.podbean.comhttps://feed.podbean.com/rideandlaugh/feed.xmlpodcastindex.org
AtalantaAtalanta142October 26, 2026Weeklypodcasters.spotify.com/pod/show/rad1https://anchor.fm/s/f36372a4/podcast/rsspodcastindex.org
Eastern Shore TalkJay Watson142October 27, 2026Weeklyeasternshoretalk.orghttps://anchor.fm/s/f2dc0648/podcast/rsspodcastindex.org
Flourshing in Faith: Jesus Changed My LifeJulie142September 17, 2026Weeklylifewithchristisbeautiful.comhttps://rss.buzzsprout.com/2372758.rsspodcastindex.org
Zone2Speak PodcastJuliana142October 29, 2026Weeklyzone2speak.podbean.comhttps://feed.podbean.com/zone2speak/feed.xmlpodcastindex.org
News for the Ages by Rethinking Aging ClubLinda Sherman and Ray Gordon142October 28, 2026Weeklyboomertechtalk.comhttps://rss.buzzsprout.com/2370721.rsspodcastindex.org
The Crystal Bar PodcastClaire Titmus & The Crystal Bar142October 28, 2026Weeklythecrystalbar.podbean.comhttps://feed.podbean.com/thecrystalbar/feed.xmlpodcastindex.org
The First Seven YearsDr. Murray Clarke & Bryce Wylde142October 30, 2026Weeklyrss.com/podcasts/the-first-seven-yearshttps://media.rss.com/the-first-seven-years/feed.xmlpodcastindex.org
Total Disruption PodcastMichael Libercci142October 29, 2026Weeklytotal-disruption-podcast.simplecast.comhttps://feeds.simplecast.com/s2cuPj_3podcastindex.org
8158 Podcast: Stories of Sacrifice8158 Podcast142October 25, 2026Weekly8158podcast.comhttps://api.riverside.fm/hosting/xdac6asa.rsspodcastindex.org
Awakening AirwavesY Williams142October 30, 2026Weeklyspreaker.com/podcast/awakening-airwaves--6619020https://www.spreaker.com/show/6619020/episodes/feedpodcastindex.org
In a Nutshell: The Plant-Based Health Professionals UK PodcastInANutshell142October 28, 2026Every two weeksspreaker.com/podcast/in-a-nutshell-the-plant-based-health-professionals-uk-podcahttps://www.spreaker.com/show/6687793/episodes/feedpodcastindex.org
Fasting SpacePhil Zimmermann, MD142October 30, 2026Several times a weeksimplefasting.comhttps://feeds.transistor.fm/fasting-spacepodcastindex.org
H.O.P.E - Hang On Pain EndsAlana Michaels142October 4, 2026Several times a weekrss.com/podcasts/hang-on-pain-endshttps://media.rss.com/hang-on-pain-ends/feed.xmlpodcastindex.org
The Ninja FamPlay.Works142October 29, 2026Weeklyninjakidz.comhttps://feeds.megaphone.fm/IKLKT4008907977podcastindex.org
TAKE A DEEP BREATHMike Maher141October 15, 2026Monthlybuzzsprout.com/1171214https://rss.buzzsprout.com/1171214.rsspodcastindex.org
Sauna TalkSaunaTimes141October 23, 2026Monthlysaunatimes.libsyn.comhttps://saunatimes.libsyn.com/rsspodcastindex.org
Birth MattersLisa Taylor - Birth Matters NYC Childbirth Education & Labor Support141October 24, 2026Monthlybirthmattersshow.comhttps://rss.buzzsprout.com/310952.rsspodcastindex.org
HONEY on the SWORDMarini Facey141October 11, 2026Monthlypodcasters.spotify.com/pod/show/marini-faceyhttps://anchor.fm/s/24a6015c/podcast/rsspodcastindex.org
The Richard Nicholls Mental Health PodcastRichard Nicholls141October 30, 2026Monthlyrichardnicholls.nethttps://feeds.feedburner.com/richardnichollspodcastindex.org
The Revital Health PodcastRevital Health Podcast141October 28, 2026Monthlyrevitalhealth.com.au/category/the-revital-health-podcasthttps://feeds.captivate.fm/the-revital-health/podcastindex.org
Infertility FeelingsJesse and Doug from Uniquely Knitted141October 26, 2026Every two weeksinfertilityfeelingspodcast.buzzsprout.comhttps://rss.buzzsprout.com/1357159.rsspodcastindex.org
Higher Self with Carina ShinesCarina Shines141October 28, 2026Every two weeksmatriarchmedicine.shophttps://rss.buzzsprout.com/1593913.rsspodcastindex.org
The Empowered Feminine With Ciara FoyCiara Foy141September 16, 2026Every two weeksciarafoy.comhttps://rss.buzzsprout.com/1359526.rsspodcastindex.org
From Darkness to Life Podcast: Stories of Recovery & ResilienceOur Collective Journey141October 29, 2026Every two weeksredcircle.com/shows/from-darkness-to-lifehttps://feeds.redcircle.com/3d4c31d4-8cc0-42d9-bbde-f53aef26717dpodcastindex.org
Purpose Served PodcastDarryl Wingfield141October 27, 2026Every two weekspurposeserved.comhttps://rss.buzzsprout.com/1425349.rsspodcastindex.org
Keeping Ashland HealthyWMAN AM & FM (WMAN-AM)141September 17, 2026Every two weeksiheart.com/podcast/82735053https://www.spreaker.com/show/4932225/episodes/feedpodcastindex.org
The Cancer Liberation ProjectHayley Dubin141October 15, 2026Every two weeksredcircle.com/shows/the-cancer-liberation-projecthttps://feeds.redcircle.com/35a8f34b-49ea-46d9-9987-86798c9c4417podcastindex.org
Up Your Total GlowRuth Balsiger141October 17, 2026Every two weeksithriveforhealth.comhttps://rss.buzzsprout.com/1848014.rsspodcastindex.org
The Resilient Living PodcastTerrilyn Minnifield141October 28, 2026Every two weeksterrilynminnifield.comhttps://rss.buzzsprout.com/1835829.rsspodcastindex.org
The Tongue Tie Experts PodcastLisa Paladino CNM IBCLC141October 30, 2026Every two weekstonguetieexperts.net/podcasthttps://feeds.captivate.fm/tongue-tie-experts/podcastindex.org
The Grief GangAmber Jeffrey141September 28, 2026Monthlythegriefgang.compodcastindex.org
Upika PodcastStudio SF141October 22, 2026Every two weeksbuzzsprout.com/1960290podcastindex.org
The Irish Hunting PodcastAnthony and Rob141October 14, 2026Every two weekstheirishhuntingpodcast.comhttps://rss.buzzsprout.com/2054899.rsspodcastindex.org
Movement Logic: Strong Opinions, Loosely HeldLaurel Beversdorf141October 28, 2026Every two weeksmovementlogictutorials.com/podcasthttps://feeds.zencastr.com/f/yWt5sRZK.rsspodcastindex.org
The Mental Offload PodcastShawna Samuel141October 20, 2026Every two weekssites.libsyn.com/423290https://feeds.libsyn.com/423290/rsspodcastindex.org
The Science of SkinA Science of Skin Podcast141October 29, 2026Every two weeksscienceofskinsummit.comhttps://rss.buzzsprout.com/2632480.rsspodcastindex.org
GynoCuriousRadio Free Rhinecliff141October 29, 2026Every two weeksgynocurious.podcast.radiofreerhinecliff.orghttps://media.zencast.fm/gynocurious/rsspodcastindex.org
Spiritual Wealth with Alexandra Savithri, M.A.Alexandra Savithri141October 31, 2026Every two weeksreikiacademy.orghttps://rss.buzzsprout.com/2183559.rsspodcastindex.org
Unsolicited Advice with Coach Joey SzolowiczJoey Szolowicz141October 28, 2026Every two weekspodcasters.spotify.com/pod/show/joey-szolowicz9https://anchor.fm/s/e4f89c58/podcast/rsspodcastindex.org
Pivot The PathScott Young141October 21, 2026Weeklyhttps://feeds.transistor.fm/pivot-the-pathpodcastindex.org
Ad's Fitness PodcastAd Thomas141October 26, 2026Weeklysites.google.com/view/adthomastraining/ad-thomas-traininghttps://anchor.fm/s/ea985838/podcast/rsspodcastindex.org
Stories from the Village of Nothing MuchWellness Loud141October 26, 2026Weeklynothingmuchhappens.com/stories-from-the-villagehttps://feeds.megaphone.fm/SSM9101815487podcastindex.org
The Playbook with Colin JonovColin Jonov141October 29, 2026Weeklybuzzsprout.com/2280421https://rss.buzzsprout.com/2280421.rsspodcastindex.org
Life With Danni DuncanDanni Duncan141October 28, 2026Weeklythefigurelife.com/lifewithdanniduncanhttps://anchor.fm/s/11568fba8/podcast/rsspodcastindex.org
Radiant Resilience - Real Conversations with Tawny PalmTawny Palm141October 26, 2026Weeklybuzzsprout.com/2287103https://api.riverside.fm/hosting/gHVivbRl.rsspodcastindex.org
Broken Brains with Bruce ParkmanBruce Parkman141October 29, 2026Weeklybrokenbrainswithbruceparkman.buzzsprout.comhttps://rss.buzzsprout.com/2359455.rsspodcastindex.org
Nutrition Science Bites with Professor Clare Collins AOClare Collins141October 26, 2026Weeklynomoneynotime.com.aupodcastindex.org
Recovery Tools and ChallengesAngela Dowling141October 15, 2026Weeklyspreaker.com/podcast/recovery-tools-and-challenges--6235300https://www.spreaker.com/show/6235300/episodes/feedpodcastindex.org
The Body Recomposition Revolution | Fat Loss and Strength for Women 35+RAC Fitness - Robyn Creary141October 29, 2026Weeklythebodyrecomprevolution.podview.comhttps://anchor.fm/s/fbf7efd0/podcast/rsspodcastindex.org
Hammer and Chisel Performance PodcastJon Heck141October 29, 2026Weeklyhammerchiselperformance.comhttps://anchor.fm/s/fff8758c/podcast/rsspodcastindex.org
Iron Suits:For Men Who Built Everything But Their BodyMarwan Killu141October 27, 2026Several times a weekironsuitspodcast.comhttps://feed.podbean.com/marwank/feed.xmlpodcastindex.org
The Morning CommuteBetter Together141October 30, 2026Several times a weekrss.com/podcasts/the-morning-commutehttps://media.rss.com/the-morning-commute/feed.xmlpodcastindex.org
Living Beyond ADHDDrB141October 27, 2026Monthlydrbarbaracohen.com/Podcasthttps://rss.buzzsprout.com/2620654.rsspodcastindex.org
Dentist on Demand - DentalBytesDentist on Demand140October 1, 2026Monthlydentistondemand.comhttps://rss.buzzsprout.com/890125.rsspodcastindex.org
Voice In SportStefanie Strack140October 13, 2026Monthlybuzzsprout.com/1008523https://rss.buzzsprout.com/1008523.rsspodcastindex.org
Back into AlignmentJoa Rivas140August 29, 2026Monthlyjoafitness.comhttps://joafitness.libsyn.com/rsspodcastindex.org
GraceStory PodcastGraceStory140October 15, 2026Monthlygracestory.podbean.comhttps://feed.podbean.com/gracestory/feed.xmlpodcastindex.org
Restored 2 MoreCharity & Clinton Muñoz140October 27, 2026Monthlyrestored2more.comhttps://rss.buzzsprout.com/926329.rsspodcastindex.org
Botox and BurpeesDr. Sam Rhee140October 25, 2026Monthlybergencosmetic.com/podcasthttps://rss.buzzsprout.com/1063975.rsspodcastindex.org
Rainbows RisingRainbow Raaja140September 30, 2026Monthlyrainbowraaja.lovehttps://rss.buzzsprout.com/1299739.rsspodcastindex.org
Deep BreathsDeep Breaths140October 4, 2026Monthlydeepbreathspod.buzzsprout.comhttps://rss.buzzsprout.com/1312792.rsspodcastindex.org
Get Big Out Loud with Kari: Living the Complex, Funny, & Beautiful Ride of LifeKari Knutson140October 12, 2026Monthlyknutsonspeaks.comhttps://www.spreaker.com/show/4638782/episodes/feedpodcastindex.org
Being Known PodcastBeing Known Podcast140October 28, 2026Every two weeksthebeingknownpodcast.podbean.comhttps://feed.podbean.com/thebeingknownpodcast/feed.xmlpodcastindex.org
Boyfriend Material with Harry JowseyUnwell140October 30, 2026Weeklyiamunwell.comhttps://feeds.simplecast.com/Hw9fG_Jtpodcastindex.org
Style and Stewardship | Holistic Health for Christian Women: Inflammation, Blood Sugar, Gut Health & Biblical StewardshipCher Certified Holistic Nutrition Practitioner140October 26, 2026Monthlystyleandstewardship1.podbean.comhttps://feed.podbean.com/styleandstewardship1/feed.xmlpodcastindex.org
Create Your Own LightPodcast with Travis Howze140August 31, 2026Every two weekscreateyourownlight.buzzsprout.comhttps://rss.buzzsprout.com/1614748.rsspodcastindex.org
Sleep TakeoutSleep Takeout140October 27, 2026Every two weekssleeptakeout.buzzsprout.comhttps://rss.buzzsprout.com/1692604.rsspodcastindex.org
Free and Redeemed Podcast ShowSimon140September 12, 2026Every two weeksfreeandredeemedpodcastshow.buzzsprout.comhttps://rss.buzzsprout.com/1990720.rsspodcastindex.org
IVF Prep at HealthYouniversityDr. Susan Fox140October 25, 2026Every two weekshealthyouniversity.cohttps://rss.buzzsprout.com/2075436.rsspodcastindex.org
Sprinkles Of SpiritLisa Flora140October 20, 2026Every two weekssprinklesofspirit.buzzsprout.comhttps://rss.buzzsprout.com/2103407.rsspodcastindex.org
The MFS Wellness PodcastMike Sinopoli140October 26, 2026Every two weeksspreaker.com/show/the-mfs-wellness-podcasthttps://www.spreaker.com/show/5532762/episodes/feedpodcastindex.org
Health: No Filter140September 30, 2026Every two weekspod.co/over-40s-fitness-with-tristan-lowehttps://feed.pod.co/over-40s-fitness-with-tristan-lowepodcastindex.org
Scars to Stars™ PodcastDeana Brown Mitchell140October 28, 2026Every two weeksscars-to-stars-podcast.captivate.fmhttps://feeds.captivate.fm/scars-to-stars-podcast/podcastindex.org
The Triathlon ShowThe Triathlon Show140October 23, 2026Every two weeksthetriathlonshow.comhttps://anchor.fm/s/e1ce1a1c/podcast/rsspodcastindex.org
The Talking Apron with Anne Bernardin: Conversations about Nutrition, Habits and Healthy AgingAnne Bernardin140October 14, 2026Every two weekssites.libsyn.com/474972https://feeds.libsyn.com/474972/rsspodcastindex.org
Through the Trauma PodcastThrough the Trauma Podcast140August 14, 2026Every two weeksanchor.fm/through-the-trauma-podhttps://anchor.fm/s/db3f385c/podcast/rsspodcastindex.org
Health WealthIndia Today Podcasts140October 29, 2026Every two weekspodcasts.indiatoday.in/podcast/health-wealthhttps://www.spreaker.com/show/5918323/episodes/feedpodcastindex.org
She Should KnowSarah Hemeida & Sarah Ahmed140October 26, 2026Every two weekssheshouldknow.buzzsprout.comhttps://rss.buzzsprout.com/2245534.rsspodcastindex.org
The Ageless TravelerAdriane Berg140October 27, 2026Weeklyagelesstraveler.comhttps://rss.buzzsprout.com/2251907.rsspodcastindex.org
Bioenergetics BeatHeather Gray FDN-P140October 30, 2026Every two weekswearenikki.com/podcasthttps://anchor.fm/s/e59a5ee4/podcast/rsspodcastindex.org
Living in His Purpose | Renew Your Mind with Biblical TruthEve King, Christian Mindset Life Coach, Speaker, Professional Organizer, Nurse140September 11, 2026Weeklylivinginhispurposelifecoaching.podbean.comhttps://feed.podbean.com/livinginhispurposelifecoaching/feed.xmlpodcastindex.org
Tenacity with Sonia C.Sonia Couto140October 29, 2026Weeklyredcircle.com/shows/tenacity-with-sonia-chttps://feeds.redcircle.com/4b4bea5f-1c7e-4391-8677-58e051a95207podcastindex.org
A pinch of salt - A podcast by ERAEuropean Renal Association140October 15, 2026Weeklybuzzsprout.com/2292401https://rss.buzzsprout.com/2292401.rsspodcastindex.org
Modern Body: Pilates & Movement for LifeAly DiRoma140October 30, 2026Weeklymodern-body.captivate.fmhttps://feeds.captivate.fm/modern-body/podcastindex.org
Brainstorms: Functional Neurorehab for SLPsRenee Garrett, MSEd, CCC-SLP, CBIS140October 22, 2026Weeklyspeechtherapypd.comhttps://feeds.captivate.fm/brainstorms-slp/podcastindex.org
MedEvidence ArticlesMedEvidence Articles140October 26, 2026Every two weeksencoredocs.comhttps://rss.buzzsprout.com/2322000.rsspodcastindex.org
Living Vine ChroniclesLogo design: Jeff Hilliard, Music: Lucas Winkler and Justin McGraw140October 26, 2026Weeklybuzzsprout.com/2309250https://rss.buzzsprout.com/2309250.rsspodcastindex.org
The Wellness ProcessElizabeth Endres140October 27, 2026Weeklyart19.com/shows/the-wellness-processhttps://rss.art19.com/the-wellness-processpodcastindex.org
Rooted in Wellness with Mona SharmaMona Sharma140October 28, 2026Weeklymonasharma.com/podcasthttps://rss2.flightcast.com/iefa8pe618nydqg68b8ursda.xmlpodcastindex.org
The Gay Monogamy Coach.Alan Cox140September 16, 2026Weeklygaymonogamycoach.buzzsprout.comhttps://rss.buzzsprout.com/2377983.rsspodcastindex.org
Happy Healthy Whole & RichTina Brinkley Potts140August 25, 2026Several times a weekhappyhealthywholerich.comhttps://feeds.captivate.fm/happy-healthy-whole-rich/podcastindex.org
TOWARD LIFE-KNOWLEDGE140September 19, 2026Dailybsahely.comhttps://bsahely.com/category/podcast/feed/podcastindex.org
Clean Food ScoreClean Food Score140October 19, 2026All episodes at oncecleanfoodscore.comhttps://podfeast.com/show/clean-food-score/feed.xmlpodcastindex.org
Inside Trader Joe'sTrader Joe's139October 26, 2026Monthlytraderjoes.com/home/podcasthttps://insidetjs.libsyn.com/rsspodcastindex.org
Tripawd Talk RadioTripawds139October 23, 2026Monthlytripawds.comhttps://rss.buzzsprout.com/258389.rsspodcastindex.org
Prognosis OhioPrognosis Ohio, LLC139October 21, 2026Monthlyprognosisohio.comhttps://feeds.megaphone.fm/DHT6007504357podcastindex.org
Gastrointestinal Endoscopy Monthly PodcastsElsevier139October 19, 2026Monthlygiejournal.org/content/podcast-monthlyhttps://www.giejournal.org/pb-assets/Health%20Advance/journals/ymge/monthly_podcasts/ymge_monthly_podcasts.xmlpodcastindex.org
Device Nation PodcastKevin Brown139October 29, 2026Monthlylinkedin.com/in/kevin-brown-0b74245https://rss.buzzsprout.com/786629.rsspodcastindex.org
The Cosmic Womb with Emily the MediumEmily Greene139August 31, 2026Monthlyredcircle.com/shows/emily-the-mediumhttps://feeds.redcircle.com/1602ae16-7abd-4a3d-9760-0cbe6505d940podcastindex.org
The Emergency Mind PodcastThe Emergency Mind Podcast139August 17, 2026Monthlyemergencymind.comhttps://feeds.soundcloud.com/users/soundcloud:users:668871641/sounds.rsspodcastindex.org
The Ikigai PodcastNick Kemp - Ikigai Tribe139October 30, 2026Monthlyikigaitribe.comhttps://rss.buzzsprout.com/727083.rsspodcastindex.org
SeniorLivingGuide.com PodcastSeniorLivingGuide.com139October 21, 2026Monthlyseniorlivingguide.com/podcastshttps://rss.buzzsprout.com/1311730.rsspodcastindex.org
Becker’s Healthcare -- Cardiology + Heart Surgery PodcastBecker's Healthcare139October 19, 2026Monthlybeckershospitalreview.com/podcasts.htmlhttps://feeds.blubrry.com/feeds/cardiologypodcast.xmlpodcastindex.org
Modafinil.org Ultimate Guide139October 27, 2026Monthlycastbox.fm/ch/2567713https://rss.castbox.fm/everest/96d74ec940214684b7abacee0e79f01f.xmlpodcastindex.org
Ultimate Modafinil GuideMark Anderson139October 27, 2026Monthlyspreaker.com/podcast/ultimate-modafinil-guide--4204441https://www.spreaker.com/show/4204441/episodes/feedpodcastindex.org
What's the Word?Jaime McFaden139August 14, 2026Every two weeksbuzzsprout.com/663151https://rss.buzzsprout.com/663151.rsspodcastindex.org
MelhikGreat Commission Ministry Ethiopia139October 24, 2026Every two weeksredcircle.com/shows/melhikpodcasthttps://feeds.redcircle.com/e70b3221-765d-4038-abcd-31b15f9057e7podcastindex.org
Acupuncture Marketing SchoolMichelle Grasek, MS, L.Ac.139October 27, 2026Every two weeksmichellegrasek.com/bloghttps://rss.buzzsprout.com/1615306.rsspodcastindex.org
The Pelvic Floor ProjectMelissa Dessaulles | The Pelvic Floor Project139October 19, 2026Every two weeksbuzzsprout.com/1722389https://rss.buzzsprout.com/1722389.rsspodcastindex.org
PrevenTablePreventEd | Hubbard Radio139October 21, 2026Every two weeksart19.com/shows/preventablehttp://feeds.feedburner.com/preventablepodcastindex.org
ESPGHAN PodcastESPGHAN139October 19, 2026Every two weeksespghan.orghttps://cdn.stationista.com/feeds/espghanpodcastindex.org
Believe Big PodcastIvelisse Page139October 20, 2026Every two weeksbelievebigpodcast.buzzsprout.comhttps://rss.buzzsprout.com/1892370.rsspodcastindex.org
Sleep Noise BedtimeSleep Noise for Deep, Calming Sleep139October 30, 2026Every two weekssleepnoisebedtime.comhttps://www.sleepnoisebedtime.com/feed.xmlpodcastindex.org
How to Lose the Wait | Women Over 50Holly Toscanini | Women's Confidence139October 26, 2026Every two weekshowtolosethewait.comhttps://api.riverside.fm/hosting/WE9kn5Rx.rsspodcastindex.org
Sleep Noise BedtimeSleep Noise for Deep, Calming Sleep139October 30, 2026Every two weekssleepnoisebedtime.comhttps://feed.podbean.com/sleepnoisebedtime/feed.xmlpodcastindex.org
Functionally Enlightened - Better ways to heal from chronic pain and illnessFunctionally Enlightened139October 29, 2026Every two weeksfunctionallyenlightened.comhttps://anchor.fm/s/daa3de0c/podcast/rsspodcastindex.org
Outdoor SoundsCome Alive Creative139October 29, 2026Every two weeksoutdoorsounds.orghttps://feeds.megaphone.fm/outdoor-soundspodcastindex.org
The Education Hub - Conversation with the expertsThe Education Hub - The Royal Children’s Hospital Melbourne139October 27, 2026Monthlyeducationhubcwte.podbean.comhttps://educationhubcwte.podbean.com/feed.xmlpodcastindex.org
Trusting DorothyDorothy McGatlin139October 20, 2026Every two weeksdorothymcgatlin.com/podcasts/trusting-dorothyhttps://app.kajabi.com/podcasts/2147535892/feedpodcastindex.org
Simple Nutrition InsightsLeonila139September 28, 2026Weeklysimplenutritionpodcast.buzzsprout.comhttps://rss.buzzsprout.com/2300296.rsspodcastindex.org
Healthy SystemsMoe Ghias139October 30, 2026Weeklyhealthy-systems.captivate.fmhttps://feeds.captivate.fm/healthy-systems/podcastindex.org
Good Enough CounsellorsJosephine Hughes139October 29, 2026Weeklyjosephinehughes.com/good-enough-counsellors-podcasthttps://feeds.captivate.fm/good-enough-counsellors/podcastindex.org
SoultureTim Doyle139October 28, 2026Weeklysoulture.buzzsprout.comhttps://rss.buzzsprout.com/2329221.rsspodcastindex.org
The Cynthia Manion ShowCynthia Manion139October 29, 2026Every two weekscynthiamanion.comhttps://anchor.fm/s/e30a4590/podcast/rsspodcastindex.org
The Quint's VideosThe Quint139October 23, 2026Weeklybingepods.comhttps://feeds.megaphone.fm/ISP2652603354podcastindex.org
Save Your Thyroid with Jennifer HolkemJennifer Holkem139October 20, 2026Every two weekssaveyourthyroidwithjen.comhttps://feeds.acast.com/public/shows/680a3f2dfb0ce1f7b182e626podcastindex.org
Faith & Focus: A Moment for Your Mind💠 Gigi Parker, Brain and Mental Health Coach (BCMHC, BCBHC)139October 29, 2026Several times a weekpodcasters.spotify.com/pod/show/gigi-bee6https://anchor.fm/s/107a1fe48/podcast/rsspodcastindex.org
Endurance UnlimitedTrainingPeaks138October 7, 2026Monthlytrainingpeaks.comhttps://feeds.megaphone.fm/TRPK4456972027podcastindex.org
Tri Talking SportJoanne Murphy138September 2, 2026Monthlytritalkingsport.comhttps://feeds.transistor.fm/tri-talking-sportpodcastindex.org
Fresh Takes On TechInternational Fresh Produce Association138October 6, 2026Every two weeksfreshproduce.com/resources/technology/takes-on-tech-podcasthttps://feeds.captivate.fm/fresh-takes-on-tech/podcastindex.org
Runāt ar GintuGinta Ratniece138October 13, 2026Monthlygintaruna.substack.com/podcastpodcastindex.org
The LowDOWN: A Down Syndrome PodcastDown Syndrome Resource Foundation138October 28, 2026Monthlydsrf.orghttps://rss.buzzsprout.com/862549.rsspodcastindex.org
Leveled Up FriendshipsZoe Asher138September 24, 2026Every two weeksaccidentallyintentionalpod.comhttps://rss.buzzsprout.com/1395811.rsspodcastindex.org
Evolve Your Intimacy w/ Dr. StephanieDr. Stephanie Sigler CST, LPC, PhD138October 28, 2026Monthlyevolveyourintimacy.comhttps://rss.buzzsprout.com/903517.rsspodcastindex.org
Pets Who Thrive!Tammy Doak138September 25, 2026Every two weeksbuzzsprout.com/1518400https://rss.buzzsprout.com/1518400.rsspodcastindex.org
The Men's CollectiveTravis Goodman, LMFT138October 20, 2026Every two weekstravisgoodmanlmft.com/collectivehttps://feeds.zencastr.com/f/U-tMIPiv.rsspodcastindex.org
The First Gen MadrinaSara Diaz138October 27, 2026Every two weeksthefirstgenmadrina.buzzsprout.comhttps://app.kajabi.com/podcasts/2147501309/feedpodcastindex.org
TOP SELF | Tips on Jealousy and Insecurity in RelationshipsShanenn Bryant138September 8, 2026Every two weekstopself.comhttps://rss.buzzsprout.com/2016773.rsspodcastindex.org
Mountain CogJosh Anderson & Dane Higgins138October 20, 2026Every two weeksmountaincog.comhttps://rss.buzzsprout.com/2052531.rsspodcastindex.org
evokecastCoach Scott Johnston and the Evoke Endurance Collective138October 28, 2026Every two weeksevokeendurance.comhttps://rss.buzzsprout.com/2065266.rsspodcastindex.org
Survived to Thrive - Life After Suicide Loss PodcastAmy Miller138October 28, 2026Every two weekssurvived-to-thrive.comhttps://rss.buzzsprout.com/2076031.rsspodcastindex.org
Vive con HuevosSonoro | Vive con Huevos138October 28, 2026Every two weekshttps://feeds.megaphone.fm/SONORO2814680270podcastindex.org
Meet Me at the Spot: Where Pleasure Meets EducationHolly Eckelberger138October 29, 2026Every two weeksthatsexeducator.comhttps://api.riverside.fm/hosting/djwvzfPA.rsspodcastindex.org
Figuring Sh!t OutVanessa Fontana138October 24, 2026Every two weeksredcircle.com/shows/figuring-sht-outhttps://feeds.redcircle.com/d8fe40e8-9407-4fa0-ab82-f871192ef2cbpodcastindex.org
The Well Drop: Perimenopause Symptoms, Weight Gain, Mood & SleepAmber Berger138October 19, 2026Every two weeksredcircle.com/shows/the-well-drop9547https://feeds.redcircle.com/d51eb2db-9ba5-476a-b974-cee2794c919cpodcastindex.org
Health Futures with Host Bob RothCRC Broadcasting, Co.138October 27, 2026Weeklyart19.com/shows/health-futures-with-host-bob-rothhttps://rss.art19.com/health-futures-with-host-bob-rothpodcastindex.org
The Runs PodcastTHERUNS138October 29, 2026Weeklyshows.acast.com/the-runs-podcastpodcastindex.org
The Weight Loss HotlineNick Geoppo138October 22, 2026Weeklydropit.podbean.comhttps://anchor.fm/s/10a2800cc/podcast/rsspodcastindex.org
Simple ConversationsASG138October 7, 2026Weeklybeacons.ai/simpleconvoshttps://feeds.simplecast.com/PzDUv1pCpodcastindex.org
Beyond The Fountain Of YouthDr. Julian R. Gerson, Jr.138October 27, 2026Weeklysites.libsyn.com/513058https://feeds.libsyn.com/513058/rsspodcastindex.org
Get Trauma Informed PodcastWellness Coach Liz Blanding138October 6, 2026Weeklyoasiswellnessctrs.comhttps://rss.buzzsprout.com/2321621.rsspodcastindex.org
Fresh From the Field FridaysDan "The Produce Man" Avakian138October 30, 2026Weeklyfresh-from-the-field-fridays.captivate.fmhttps://feeds.captivate.fm/fresh-from-the-field-fridays/podcastindex.org
But You Look So GoodBut You Look So Good Podcast138October 26, 2026Weeklybutyoulooksogood.com.auhttps://anchor.fm/s/f918cce4/podcast/rsspodcastindex.org
Run Spesh Podcast by Frontrunner ColomboFrontrunner Colombo138October 29, 2026Weeklysites.libsyn.com/541637https://feeds.libsyn.com/541637/rsspodcastindex.org
Perimenopause & Motherhood: Real Life Wellbeing for Happy Thriving MumsAmanda Reidy | Perimenopause Coach, Radiate Fitness138October 29, 2026Weeklyradiatefitness.co.ukhttps://anchor.fm/s/fcec2564/podcast/rsspodcastindex.org
Deep Dive with Lindsay Hill, DNP, PMHNP - Psych NP Mentor - PMHNP MentorLindsay Hill138October 24, 2026Several times a weekpsychnpfellowship.comhttps://media.rss.com/lindsay-hill-psych-np-mentor-pmhnp-mentor/feed.xmlpodcastindex.org
Circuspreneur PodcastCircuspreneur Podcast138August 8, 2026Monthlycircuspreneur.comhttps://feeds.zencastr.com/f/cq8zEmni.rsspodcastindex.org
Conscious Curiosities with Maria Luz PodcastMaria Luz O'Rourke138October 23, 2026Weeklymarialuzorourke.substack.com/podcastpodcastindex.org
Global Trial Accelerators™: Fast-Tracking First-in-Human Trials, AnywhereJesús E. Moreno137October 23, 2026Monthlyglobaltrialaccelerators.comhttps://rss.buzzsprout.com/270132.rsspodcastindex.org
Vinnie De Rosa AKA Cuzin VinnieCuzinVinnieNetwork.com137September 21, 2026Monthlycuzinvinnienetwork.comhttps://feeds.captivate.fm/cuzinvinnienetwork/podcastindex.org
PeerView Neuroscience & Psychiatry CME/CNE/CPE Video PodcastPeerView, 24 West 40th Street, Suite 950, New York, NY 10018137October 23, 2026Every two weeksww2.peerview.comhttps://c.peerview.com/podcast/xml/neurology_video.xmlpodcastindex.org
PeerView Neuroscience & Psychiatry CME/CNE/CPE Audio PodcastPeerView, 24 West 40th Street, Suite 950, New York, NY 10018137October 23, 2026Every two weeksww2.peerview.comhttps://c.peerview.com/podcast/xml/neurology_audio.xmlpodcastindex.org
The Someone To Tell It To PodcastSomeone To Tell It To137October 13, 2026Monthlysomeonetotellitto.org/podcasts/the-someone-to-tell-it-to-podcasthttps://app.kajabi.com/podcasts/2147581102/feedpodcastindex.org
The Platform PodcastJordan Kunde-Wright137August 11, 2026Monthlytwincitieskettlebellclub.comhttps://anchor.fm/s/21af262c/podcast/rsspodcastindex.org
FebrileSara Dong137October 12, 2026Every two weeksfebrilepodcast.comhttps://feeds.captivate.fm/febrilepodcast/podcastindex.org
The FAKTR PodcastJessica Riddle, Todd Riddle137October 3, 2026Every two weeksfaktrpodcast.comhttps://www.spreaker.com/show/4869183/episodes/feedpodcastindex.org
Katie The Traveling Lactation ConsultantKatie137October 27, 2026Every two weeksbuzzsprout.com/1784385https://rss.buzzsprout.com/1784385.rsspodcastindex.org
The Happy Healthy Strong PodcastDr. Alex Arguello137October 26, 2026Every two weekspodcasters.spotify.com/pod/show/happyhealthystrongpodcasthttps://anchor.fm/s/6942480c/podcast/rsspodcastindex.org
Recovery Coast to CoastNeil Scott137October 25, 2026Every two weeksrecoverycoasttocoast.comhttps://feeds.libsyn.com/322598/rsspodcastindex.org
Therapy Is Life w/ Gerald McgeeEveryday People Indv/Fam Counseling137October 27, 2026Every two weekseverydaypeoplecounseling.ushttps://feeds.megaphone.fm/RMTV4704702760podcastindex.org
Strange Rare Peculiar Homeopathy PodcastThe Institute for the Advancement of Homeopathy137October 27, 2026Every two weeksacademyofhomeopathyeducation.comhttps://anchor.fm/s/8c520a30/podcast/rsspodcastindex.org
The Anxiety Recovery PodcastValerie Rubin137October 29, 2026Every two weeksvalrubin.comhttps://anchor.fm/s/d957ba50/podcast/rsspodcastindex.org
Holistic Dentistry Show with Dr. SandaSanda Moldovan137October 29, 2026Every two weekssites.libsyn.com/460395https://feeds.libsyn.com/460395/rsspodcastindex.org
Personal Mastery with Jerry HendersonJerry Henderson137August 14, 2026Every two weeksjerryhenderson.orghttps://rss.buzzsprout.com/2158011.rsspodcastindex.org
Confessions of a Freebird - Midlife, Divorce, Heal, and Date Differently with Somatic Experiencing, Empty Nest, Well-Being, HappinessLaurie James - Podcaster, Author, Somatic Practitioner and Coach137October 22, 2026Every two weeksconfessionsofafreebirdpodcast.buzzsprout.comhttps://rss.buzzsprout.com/2182667.rsspodcastindex.org
Uncle Marv's Unhealthy PodcastMarvin Bee137October 30, 2026Every two weeksunhealthypodcast.comhttps://feeds.captivate.fm/unhealthy-podcast/podcastindex.org
The Minimalist Educator PodcastTammy Musiowsky137October 27, 2026Every two weeksminimalisteducatorpodcast.buzzsprout.comhttps://rss.buzzsprout.com/2189953.rsspodcastindex.org
Four Burners with Josh EarlJosh Earl137October 15, 2026Every two weeksshows.acast.com/four-burners-with-josh-earlpodcastindex.org
Bombers CrossFit Crew Talkdsmayer2002137October 24, 2026Weeklybomberscrossfit.comhttps://anchor.fm/s/f13406ec/podcast/rsspodcastindex.org
The Night Feed: The Podcast for New MumsCharlotte Smith137August 12, 2026Weeklythenightfeed.co.ukhttps://rss.buzzsprout.com/2328384.rsspodcastindex.org
2 Guys 1 Scale2 Guys 1 Scale137October 29, 2026Weeklypodcasters.spotify.com/pod/show/2-guys-1-scalehttps://anchor.fm/s/f3918d60/podcast/rsspodcastindex.org
Your Checkup: Patient Education Health PodcastEd Delesky, MD and Nicole Aruffo, RN137October 26, 2026Weeklyyourcheckuppodcast.buzzsprout.comhttps://rss.buzzsprout.com/2346940.rsspodcastindex.org
A Really Good CryiHeartPodcasts137October 27, 2026Weeklyiheart.com/podcast/123675551https://www.omnycontent.com/d/playlist/e73c998e-6e60-432f-8610-ae210140c5b1/df24579c-d34d-442a-8481-b06501282e4d/10ca5a50-409d-41dc-a52d-b06501421bfc/podcast.rsspodcastindex.org
Nuance NeededAudioboom137October 27, 2026Weeklytherapyforwomencenter.com/podcasthttps://audioboom.com/channels/5161531.rsspodcastindex.org
The Modern MeetingAdam Lyons137October 29, 2026Weeklybuzzsprout.com/2422192https://rss.buzzsprout.com/2422192.rsspodcastindex.org
BABBLING BROOKBabalwa Brook137September 16, 2026Weeklybabalwabrook.comhttps://anchor.fm/s/fee95878/podcast/rsspodcastindex.org
Sleep StoriesSleep Stories137October 19, 2026Weeklysites.libsyn.com/576220https://rss.pdrl.fm/9a385b/feeds.libsyn.com/576220/rss/?redirect=falsepodcastindex.org
The Awakened Heart: A Podcast for Neurodivergent and Trauma-Experienced WomenAutumn Moran137October 28, 2026Weeklytheawakenedheartpod.buzzsprout.comhttps://rss.buzzsprout.com/2467345.rsspodcastindex.org
All Ears Hearing and Tinnitus PodcastLayne Garrett137October 30, 2026Weeklysites.libsyn.com/578375https://feeds.libsyn.com/578375/rsspodcastindex.org
Mamun's PodcastMamun137October 31, 2026Several times a weekpalmbeachregenerativeorthopedics.comhttps://rss.buzzsprout.com/2590803.rsspodcastindex.org
Lucy ASMR: Asian Whisper TherapyLucy ASMR: Asian Whisper Therapy137October 30, 2026Several times a weekpodcasters.spotify.com/pod/show/lucy-asmr-asian-whisper-thttps://anchor.fm/s/10e730604/podcast/rsspodcastindex.org
DOT Daily by dotmodesto.comDOTModesto.com137October 8, 2026Dailydotmodesto.comhttps://feeds.transistor.fm/dot-daily-by-dotmodesto-compodcastindex.org
Holistic Dentistry Show with Dr. SandaSanda Moldovan137October 29, 2026Every two weekssites.libsyn.com/460395https://rss.libsyn.com/shows/460395/destinations/3882489.xmlpodcastindex.org
TRT With Dave LeeDave Lee137October 31, 2026Dailypodcasters.spotify.com/pod/show/zach-mitchem43https://anchor.fm/s/115f0e824/podcast/rsspodcastindex.org
Yoga by Nature PodcastMorven Hamilton136October 23, 2026Monthlyyogacommunity.libsyn.com/rsshttps://yogacommunity.libsyn.com/rsspodcastindex.org
Grief is a Sneaky BitchLisa Keefauver, MSW136October 27, 2026Monthlylisakeefauver.compodcastindex.org
Doc Talk presented by Montefiore St. Luke's CornwallMontefiore St. Lukes Cornwall136August 6, 2026Monthlymontefioreslc.org/community/doc-talk-podcastshttps://support.doctorpodcasting.com/podcastfeed/256podcastindex.org
The DreamLittle Everywhere136October 31, 2026Monthlylittleeverywhere.compodcastindex.org
The Empty BowlJustin McElroy136October 20, 2026Monthlycerealously.nethttps://anchor.fm/s/6ccfb04/podcast/rsspodcastindex.org
James and Ashley Stay at HomeJames McKenzie Watson136October 20, 2026Monthlyjamesandashley.libsyn.comhttps://jamesandashley.libsyn.com/rsspodcastindex.org
Macros Inc LiveMacros Inc136August 31, 2026Monthlymi-live.simplecast.comhttps://feeds.simplecast.com/0vpazT8Gpodcastindex.org
VerifiedRxVizient Center for Pharmacy Practice Excellence136October 27, 2026Every two weeksverifiedrx.podbean.comhttps://feed.podbean.com/verifiedrx/feed.xmlpodcastindex.org
Grind$UnwineErika and Natasha136October 29, 2026Every two weeksgrindandunwine.buzzsprout.comhttps://rss.buzzsprout.com/1728492.rsspodcastindex.org
My Intimacy TherapistSade Jovanne136September 23, 2026Every two weeksmyintimacytherapist.comhttps://pinecast.com/feed/my-intimacy-therapistpodcastindex.org
Love Mia VitaGerie DiPiano136October 20, 2026Every two weeksrss.com/podcasts/lovemiavitahttps://media.rss.com/lovemiavita/feed.xmlpodcastindex.org
Zero DisturbanceKambria Evans, The Teaching & Learning EMDR Consultant136October 21, 2026Monthlyzerodisturbance.com/podcasts/zero-disturbancehttps://app.kajabi.com/podcasts/2147490972/feedpodcastindex.org
It Takes BallsTesticular Cancer Awareness Foundation136October 20, 2026Every two weekstesticularcancerawarenessfoundation.orghttps://anchor.fm/s/6db06be4/podcast/rsspodcastindex.org
Building the Elite PodcastBuilding the Elite136October 21, 2026Every two weeksbuildingtheelite.comhttps://rss.buzzsprout.com/1958852.rsspodcastindex.org
RipplesbyJiaJia136October 25, 2026Every two weeksopulencewithjia.comhttps://rss.buzzsprout.com/1961638.rsspodcastindex.org
Spirit Tree PodcastSydney Morrison | Moonlight River136October 1, 2026Every two weeksbuzzsprout.com/1981755https://rss.buzzsprout.com/1981755.rsspodcastindex.org
The LYLAS PodcastSarah and Jen136September 28, 2026Every two weeksthelylaspodcast.comhttps://rss.buzzsprout.com/2119381.rsspodcastindex.org
Fridays with Tab and ChanceDo You Believe Entertainment136October 23, 2026Every two weeksfridays-with-tab-and-chance.simplecast.comhttps://feeds.simplecast.com/kvxN6Umxpodcastindex.org
Tina's SurThrival Guide to Health over 40Tina Tang136October 20, 2026Every two weeksironstrongfitness.nethttps://anchor.fm/s/dd1ba0e8/podcast/rsspodcastindex.org
Band Director Boot CampLesley Moffat136October 28, 2026Every two weeksmpowerededucator.comhttps://media.rss.com/mpowerededucator/feed.xmlpodcastindex.org
Modern MasculinityHector Santiesteban136August 18, 2026Every two weeksmodern-masculinity.captivate.fmhttps://feeds.captivate.fm/modern-masculinity/podcastindex.org
Celebrate Muliebrity with Michelle LyonsMichelle Lyons136October 12, 2026Every two weekscelebratemuliebrity.comhttps://anchor.fm/s/e25e1004/podcast/rsspodcastindex.org
The Sober Fix PodcastDrew M.136October 23, 2026Every two weeksthesoberfixpodcast.comhttps://anchor.fm/s/e2dda044/podcast/rsspodcastindex.org
LegaskiGreg Louie136October 5, 2026Every two weekspodcasters.spotify.com/pod/show/greg-louie8https://anchor.fm/s/e366e0fc/podcast/rsspodcastindex.org
Healthy Chicago PodcastChicago Department of Public Health136October 29, 2026Every two weekschicago.gov/city/en/depts/cdph.htmlhttps://anchor.fm/s/ec38083c/podcast/rsspodcastindex.org
Mics To Millions: Podcast Growth & Monetization Strategies for Health & Wellness PodcastersMics to Millions136October 28, 2026Weeklypodwritten.com/mics-to-millionshttps://feed.podbean.com/micstomillions/feed.xmlpodcastindex.org
Beyond Skin Picking & Hair PullingRaffaela136October 27, 2026Weeklybeyondskinpickinghairpulling.buzzsprout.comhttps://rss.buzzsprout.com/2325139.rsspodcastindex.org
Savagely ScaledBlake Walker and Joyce Santos136October 20, 2026Weeklypodcasters.spotify.com/pod/show/savagelyscaledhttps://anchor.fm/s/f03a0304/podcast/rsspodcastindex.org
The Cabrera Lab PodcastDrs. Derek and Laura Cabrera136October 28, 2026Weeklybuzzsprout.com/2279323https://rss.buzzsprout.com/2279323.rsspodcastindex.org
The Healthy DiaryAngela Borges136October 25, 2026Weeklythehealthydiary.co/podcasthttps://feeds.captivate.fm/the-healthy-diary/podcastindex.org
Healing Our Grieving Hearts PodcastDr. Kay Fontana136October 31, 2026Weeklyhealingourgrievinghearts.comhttps://feeds.captivate.fm/healing-our-grieving-he/podcastindex.org
Coach Em Up PodcastTim Riley136October 27, 2026Weeklypodcasters.spotify.com/pod/show/coachemuppodcasthttps://anchor.fm/s/f231d2cc/podcast/rsspodcastindex.org
The Runna PodcastRunna136October 23, 2026Weeklyrunna.compodcastindex.org
Hale(y)nessHaley Cordova136October 27, 2026Every two weekspodcasters.spotify.com/pod/show/haley-cordovahttps://anchor.fm/s/a62dc8e0/podcast/rsspodcastindex.org
Melody's Ambience SleepMelody136October 27, 2026Weeklypodcasters.spotify.com/pod/show/melody4117https://anchor.fm/s/105ecab34/podcast/rsspodcastindex.org
Yoga by Nature PodcastMorven Hamilton136October 23, 2026Monthlyyogacommunity.libsyn.com/rsshttps://rss.libsyn.com/shows/44745/destinations/144590.xmlpodcastindex.org
So Ready For Health's PodcastSo Ready For Health135October 4, 2026Monthlysoreadyforhealth.comhttps://rss.buzzsprout.com/838417.rsspodcastindex.org
Fathoms | An Enneagram PodcastLiminal Podcasts135August 27, 2026Monthlyfathomspodcast.comhttps://feeds.captivate.fm/fathoms/podcastindex.org
Dancing With My Demons PodcastRen135October 15, 2026Monthlydancingwithmydemons69.buzzsprout.comhttps://rss.buzzsprout.com/1373095.rsspodcastindex.org
JAMA Surgery Author InterviewsAmerican Medical Association135October 28, 2026Monthlyjamanetwork.com/journals/jamasurgery/pages/jama-surgery-author-interviewshttps://jamasurgeryauthorinterviews.libsyn.com/rsspodcastindex.org
Touchy Subjects PodcastShawn and Amanda135September 18, 2026Monthlytouchysubjectspodcast.comhttps://rss.buzzsprout.com/717360.rsspodcastindex.org
The Hot FlushKayte Murphy and Kim Berry135October 22, 2026Monthlyhttps://feeds.megaphone.fm/THOOO6035827946podcastindex.org
The Finding Peace PodcastTroy L Love/ Finding Peace Consulting, llc135October 13, 2026Monthlythefindingpeacepodcast.podbean.comhttps://feed.podbean.com/thefindingpeacepodcast/feed.xmlpodcastindex.org
Speaking Of Love PodcastLa Toya Bond135September 26, 2026Monthlyfacebook.com/speakingoflovepodcasthttps://anchor.fm/s/18ec6734/podcast/rsspodcastindex.org
Luscious Living PodcastSelin Bilgin135October 27, 2026Monthlyselinbilgin.com/podcastshttps://rss.buzzsprout.com/1354405.rsspodcastindex.org
Louder Than Silence PodcastLouder Than Silence135October 29, 2026Monthlylouderthansilence.orghttps://anchor.fm/s/3428ba70/podcast/rsspodcastindex.org
Behavioral Health IntegrationJacob Minnig135September 22, 2026Every two weekspod.co/behavioral-health-integrationhttps://feed.pod.co/behavioral-health-integrationpodcastindex.org
Embrace It All!Angela Adams135August 27, 2026Every two weeksangelaadamscoaching.comhttps://rss.buzzsprout.com/1810771.rsspodcastindex.org
Whole Without Hiding Podcast with Sarah I. FoxSarah I. Fox135September 15, 2026Every two weekswholewithouthiding.comhttps://anchor.fm/s/7214fe84/podcast/rsspodcastindex.org
The Ready With Sheri ShowSheridan Jackson135October 11, 2026Every two weekspodcasts.apple.com/au/podcast/the-ready-with-sheri-show/id1599715143https://rss.buzzsprout.com/1900230.rsspodcastindex.org
Strong with JulieJulie135August 28, 2026Every two weeksjuliexfit.comhttps://anchor.fm/s/83808594/podcast/rsspodcastindex.org
PediaCast CME: Pediatric Podcasts for ProvidersMichael Patrick135September 15, 2026Monthlypediacastcme.orghttps://feeds.libsyn.com/64293/rsspodcastindex.org
LET IT BE : LEGACYHonorthi135October 9, 2026Every two weeksredcircle.com/shows/let-it-be-legacyhttps://feeds.redcircle.com/5e601408-8932-46bc-be51-68e3a987e18apodcastindex.org
Unbottled PotentialAmanda Kuda135October 15, 2026Every two weeksamandakuda.com/podcasthttps://feeds.libsyn.com/428352/rsspodcastindex.org
The Motivation Mindset with Risa WilliamsRisa Williams135October 13, 2026Every two weeksrisawilliams.com/motivationmindset.htmlhttps://rss.buzzsprout.com/2036859.rsspodcastindex.org
The Petty Herbalist PodcastPetty Herbalist135October 24, 2026Every two weekspettyherbalist.comhttps://anchor.fm/s/42f5040/podcast/rsspodcastindex.org
Happy to See Me with Erika CasupananThe Sonar Network135September 14, 2026Every two weeksthesonarnetwork.com/happy-to-see-mehttps://thesonarnetwork.com/happy-to-see-me/feed/podcastpodcastindex.org
Sex, Love & Everything In BetweenMeg and Jacob O'Neill135October 27, 2026Every two weekssexloveeverythinginbetween.buzzsprout.comhttps://rss.buzzsprout.com/2121070.rsspodcastindex.org
The Wellbeing RebellionNgozi Weller & Obehi Alofoje135October 29, 2026Every two weeksthe-wellbeing-rebellion.captivate.fmhttps://feeds.captivate.fm/the-wellbeing-rebellion/podcastindex.org
In Bed With The RightAdrian Daub and Moira Donegan135October 30, 2026Every two weeksrss.com/podcasts/inbedwiththerighthttps://media.rss.com/inbedwiththeright/feed.xmlpodcastindex.org
Thriving On PurposeNechama Weiser135October 28, 2026Every two weeksnechamaweisercoaching.podbean.comhttps://feed.podbean.com/nechamaweisercoaching/feed.xmlpodcastindex.org
Health Talk | Dr. Fred Lowry Jr.WSIC135August 21, 2026Every two weekshttps://feeds.transistor.fm/health-talk-dr-fred-lowry-jrpodcastindex.org
AND/BOTH Podcast - Real Conversations, Shared Experiences, and the Community You've Been MissingDr. Ashley Blackington135October 30, 2026Every two weeksandbothpodcast.comhttps://feeds.captivate.fm/and-both-podcast/podcastindex.org
Holistic Health HeroesKery Knutson135October 25, 2026Every two weeksngvitamins.comhttps://rss.buzzsprout.com/2268995.rsspodcastindex.org
Wholistic LivingMarla Pietruszko135October 20, 2026Every two weeksholisticspring.comhttps://www.spreaker.com/show/5815119/episodes/feedpodcastindex.org
Soles to Soul Care for Trauma and AuDHD with Eve Menezes CunninghamEve Menezes Cunningham135October 27, 2026Weeklysolestosoul.ie/podcasthttps://feeds.captivate.fm/soles-to-soul/podcastindex.org
What the Health?!Fubar Radio135October 28, 2026Weeklyfubarradio.com/shows/what-the-healthhttps://feeds.sharp-stream.com/content/fubar_radio/feed-files/what_the_health.xmlpodcastindex.org
Love, Happiness, and Success For TherapistsYAP Media Network | Dr. Lisa Marie Bobby135October 28, 2026Weeklygrowingself.com/therapistshttps://feeds.megaphone.fm/YAP8555602191podcastindex.org
Strength To BuildChelsey Rose135October 20, 2026Weeklybuzzsprout.com/2312801https://rss.buzzsprout.com/2312801.rsspodcastindex.org
The Wild Chaos PodcastBam - The Wild Chaos135October 26, 2026Weeklywildchaosshow.comhttps://feeds.captivate.fm/the-wild-chaos-podcast/podcastindex.org
The Strong Healthy Happy PodcastCoaching with Debra135October 22, 2026Weeklycoachingwithdebra.co.ukhttps://anchor.fm/s/e9480884/podcast/rsspodcastindex.org
Long Winded with Gabby WindeySiriusXM | Long Winded with Gabby Windey135October 29, 2026Weeklysiriusxm.comhttps://feeds.simplecast.com/u9YeP8xwpodcastindex.org
The Holistic CounselorDiana S. Rice135October 28, 2026Weeklytheholisticcounselor.comhttps://feeds.libsyn.com/513523/rsspodcastindex.org
Fatherhood in FocusThe Modern Fatherhood Club135October 30, 2026Weeklyfatherhoodinfocus.podbean.comhttps://feed.podbean.com/fatherhoodinfocus/feed.xmlpodcastindex.org
Welcome to the 411Raymond Brown, Clarence Matthews, North Clinton Ave Church of Christ135October 21, 2026Weeklyncacoc.orghttps://rss.buzzsprout.com/2436410.rsspodcastindex.org
FR, Letʼs Talk: Real Talk + Biblical Truth for Christian Teen GirlsKaase Levell135October 12, 2026Weeklyfrletstalk.comhttps://rss.buzzsprout.com/2461021.rsspodcastindex.org
Make Space Meditation + CareKayel Carroll135October 31, 2026Weeklymakespacemeditation.substack.com/podcastpodcastindex.org
The Maley WayBrendan Greeley135October 29, 2026Weeklyhttps://feeds.transistor.fm/the-maley-waypodcastindex.org
The Body's CompassMatt Sorensen135October 26, 2026Weeklyhealhub.nethttps://anchor.fm/s/ec953b9c/podcast/rsspodcastindex.org
The Cancer Journey PodcastThe Cancer Journey Institute135October 30, 2026Weeklythecancerjourney.comhttps://anchor.fm/s/f37c24e8/podcast/rsspodcastindex.org
Test Those Breasts ™️Jamie Vaughn135October 27, 2026Every two weekstestthosebreasts.buzzsprout.comhttps://api.riverside.fm/hosting/pcg3p1Zw.rsspodcastindex.org
Hospital and Internal Medicine PodcastGil Porat, M.D., FACP, CPT135September 12, 2026Monthlyhospitalmedicine.podbean.comhttps://feed.podbean.com/hospitalmedicine/feed.xmlpodcastindex.org
The Holistic CounselorDiana S. Rice135October 28, 2026Weeklytheholisticcounselor.comhttps://rss.libsyn.com/shows/513523/destinations/4403858.xmlpodcastindex.org
OccupiedBrock Cook134September 24, 2026Monthlyoccupiedpodcast.com/episodeshttps://occupiedpodcast.com/feed/podcast/podcastindex.org
Guided Jewish MeditationsGuided Jewish Meditations134September 24, 2026Monthlyguidedjewishmeditations.podbean.comhttps://feed.podbean.com/guidedjewishmeditations/feed.xmlpodcastindex.org
Experience Emerge (ExEm)Matthew Knabe, MA, LPCC-S134October 23, 2026Monthlyemerge.orghttps://rss.buzzsprout.com/882700.rsspodcastindex.org
Gut PodcastBMJ Group134October 1, 2026Monthlygutbmj.podbean.comhttp://feeds.bmj.com/gut/podcastspodcastindex.org
The Brad Rykal BriefBrad Rykal134September 5, 2026Monthlybuzzsprout.com/779189https://rss.buzzsprout.com/779189.rsspodcastindex.org
Everywhere We GoRebecca Kelly134August 6, 2026Monthlyeverywherewego.iepodcastindex.org
Swapping Secrets134October 27, 2026Monthlyoursecretspot.com.auhttps://443110877.hs-sites-ap1.com/podcasts/376839982551/rss.xmlpodcastindex.org
WorkforceRxFuturo Health134October 28, 2026Monthlyworkforce-rx-with-futuro-health.castos.comhttps://feeds.castos.com/wgrwpodcastindex.org
Island TreasuresAlison van Schie134September 23, 2026Monthlyalongsidecaregiverconsulting.cahttps://rss.buzzsprout.com/2347817.rsspodcastindex.org
UConn IM Residency Podcast 🎙️University of Connecticut Internal Medicine134September 23, 2026Every two weekspodcasters.spotify.com/pod/show/uconn-im-residencyhttps://anchor.fm/s/5e55d954/podcast/rsspodcastindex.org
Home Health Revealed (+Palliative and Hospice)Hannah Vale134October 16, 2026Every two weekshealthrevpartners.com/series/home-health-revealed-palliative-and-hospice-podcasthttps://feeds.castos.com/r34o5podcastindex.org
The Joyful Health Show: A Non-Diet Wellness Podcast for ChristiansKasey Shuler134October 27, 2026Every two weeksjoyfulhealth.co/podcasts/the-joyful-health-show-a-non-diet-wellness-podcast-for-https://app.kajabi.com/podcasts/2147493885/feedpodcastindex.org
SleepTech TalkSleepTech Talk134October 26, 2026Every two weekssleeptechtalk.comhttps://anchor.fm/s/7f880a70/podcast/rsspodcastindex.org
Your Joyful Order With Leslie MartinezLeslie Martinez134October 15, 2026Every two weeksyourjoyfulorder.buzzsprout.comhttps://rss.buzzsprout.com/1863627.rsspodcastindex.org
Dem Bois PodcastShawn Aaron134October 28, 2026Every two weeksdembois.org/podcasthttps://rss.buzzsprout.com/1989145.rsspodcastindex.org
Forgive YourselfBrenda Reiss134October 30, 2026Every two weeksbrendareisscoaching.comhttps://podcasts.helloaudio.fm/podcast/b30f419a-db16-4b0a-b4d6-24a09764d486/CsGafEHivdpodcastindex.org
Jonathan Benshimol - PodcastJonathan Benshimol134October 28, 2026Every two weeksrss.com/podcasts/jonathanbenshimolhttps://media.rss.com/jonathanbenshimol/feed.xmlpodcastindex.org
Nutrition For MortalsNutrition For Mortals134October 21, 2026Every two weeksoceansidenutrition.com/podcasthttps://rss.buzzsprout.com/2623543.rsspodcastindex.org
A Day at a Time ReflectionsJames H134October 31, 2026Every two weeksacultivatedman.gumroad.comhttps://anchor.fm/s/7bdf6530/podcast/rsspodcastindex.org
SuccessFULL With ADHDBrooke Schnittman MA, PCC, BCC134October 28, 2026Every two weekscoachingwithbrooke.com/successfull-with-adhdhttps://rss.buzzsprout.com/2131721.rsspodcastindex.org
Cycling Over SixtyTom Butler134September 14, 2026Every two weekscyclingoversixty.comhttps://rss.buzzsprout.com/2154564.rsspodcastindex.org
Armor Up with Lorayne MichaelsLorayne134October 23, 2026Every two weeksthebitesizepodcastwithloraynemichaels.buzzsprout.comhttps://rss.buzzsprout.com/2159494.rsspodcastindex.org
Limitless Health - Alternative Solutions for Women 40+Kate McDowell134September 29, 2026Every two weeksalignednaturalhealth.com/limitless-health-podcast-aligned-natural-healthhttps://app.kajabi.com/podcasts/2147512006/feedpodcastindex.org
Mucked Up My Self-Care PodcastJill Olish and Linda Bonney134October 5, 2026Every two weeksmucked-up-my-self-care.captivate.fmhttps://feeds.captivate.fm/mucked-up-my-self-care/podcastindex.org
Somatic Healing for Wellness-Focused WomenRae The Somatic Coach134September 2, 2026Every two weeksbuzzsprout.com/2224785https://rss.buzzsprout.com/2224785.rsspodcastindex.org
The Body Transformation podcastYash Jeswani134October 25, 2026Every two weekspodcasters.spotify.com/pod/show/yash-jeswani3https://anchor.fm/s/c9631720/podcast/rsspodcastindex.org
The Global Health Pharmacist PodcastGbemisola Adebisi-Jose134October 27, 2026Every two weekspodcasters.spotify.com/pod/show/aunty-pharmacist5https://anchor.fm/s/e7d658ac/podcast/rsspodcastindex.org
Heavenly Confident with Kim Reutzel | Increase Faith, Anxiety Bible Verses, Guilt & Shame, Trust in God, Thought Distortions, MindsetKim Reutzel, Masters Degree In Clinical Christian Counseling and Master Certified Neuroscience Coach134October 30, 2026Weekly2inspirellc.orghttps://feed.podbean.com/heavenlyconfident/feed.xmlpodcastindex.org
Where's The FinishWhere's The Finish134October 30, 2026Weeklywheresthefinishpodcast.comhttps://anchor.fm/s/f1f06594/podcast/rsspodcastindex.org
Psychology to Live ByDr. Chris Stevens134September 21, 2026Every two weekspodcasters.spotify.com/pod/show/chris-stevens72https://anchor.fm/s/bec28904/podcast/rsspodcastindex.org
Thriving in Plain SightBrigitt Thompson134October 14, 2026Weeklybuzzsprout.com/2333374https://rss.buzzsprout.com/2333374.rsspodcastindex.org
Hormones, Metabolism & You!Cassie Smith134October 25, 2026Weeklymodern-endocrine.com/podcasthttps://feeds.megaphone.fm/LLNNS4968684927podcastindex.org
Better BlokeBetter Bloke Project134October 20, 2026Weeklybetterblokeproject.orghttps://feeds.captivate.fm/better-bloke/podcastindex.org
KIZUKI the PodcastMae Yoshikawa134October 29, 2026Weeklyrss.com/podcasts/kizukihttps://media.rss.com/kizuki/feed.xmlpodcastindex.org
Uncover Your Eyes: The Truth About Health And WellnessDr. Meenal Agarwal134October 26, 2026Weeklysites.libsyn.com/524613https://feeds.libsyn.com/524613/rsspodcastindex.org
The Simply Strong PodcastTami Smith134October 26, 2026Weeklyfithealthymacros.comhttps://anchor.fm/s/f63c59dc/podcast/rsspodcastindex.org
The Happy Family Coach Podcast - Break Generational Cycles of Dysfunction, Heal Past Wounds, Transform Your Faith, Learn Relationship Skills, Practical ParentinDanielle Alvarez Greer - Biblical Counselor, Family Coach & Conflict Resolution Guide134October 28, 2026Weeklyhappyfamilycoach.comhttps://feed.podbean.com/thehappyfamilycoach/feed.xmlpodcastindex.org
Trifecta Collective - Finding the RootMegan Abbott134October 27, 2026Weeklysites.libsyn.com/522933https://rss.libsyn.com/shows/522933/destinations/4492818.xmlpodcastindex.org
Dr Karan ExploresOG Podcasts134October 26, 2026Weeklypodcasters.spotify.com/pod/show/dr-karan-exploreshttps://anchor.fm/s/f661ff5c/podcast/rsspodcastindex.org
Hear Us OutDrs. Eric Sandler and Michelle Schechter134October 26, 2026Weeklyhearusoutpodcast.com/podcasthttps://media.rss.com/hear-us-out-pod1/feed.xmlpodcastindex.org
The NFP PodcastAmy Smith134October 28, 2026Weeklyshows.async.com/episode-1-what-is-nfp-part-1-eTxYpuhWhttps://feeds.podcastle.ai/cd08593d-83a8-4dc0-9be0-0d37935080a8.rsspodcastindex.org
The Mycelium MysteriesMark M. Whelan and Ana Gomez de Leon134October 28, 2026Weeklyfuturecenterventures.comhttps://anchor.fm/s/1049f91c4/podcast/rsspodcastindex.org
The Real Longevity PodcastMike Hendricks134October 26, 2026Several times a weekbebuiltfit.com/homehttps://api.riverside.fm/hosting/PCmkwqfB.rsspodcastindex.org
Disorganized Productions: Chaos Creates HarmonyRob Nolken134October 31, 2026Every two weeksspreaker.com/podcast/disorganized-productions-chaos-creates-harmony--7012172https://www.spreaker.com/show/7012172/episodes/feedpodcastindex.org
Age Well with Dr Sophie ShotterDr Sophie Shotter134October 27, 2026Every two weeksage-well-with-dr-sophie-shotter.podigee.iohttps://rss.buzzsprout.com/2622823.rsspodcastindex.org
The Somatic Strength CollectiveMandy L Ryle134October 20, 2026Monthlyempoweredself.mehttps://rss.buzzsprout.com/1924439.rsspodcastindex.org
Healthy Immune DocHealthy Immune Doc134October 31, 2026Dailyyoutube.com/channel/UCjrE1Mdf8JKg6iu3_CvmtgAhttps://feeds.megaphone.fm/healthy-immune-docpodcastindex.org
Mental Health + Aging with Dr. Regina KoeppDr. Regina Koepp133October 27, 2026Monthlymentalhealthandaging.comhttps://rss.buzzsprout.com/952579.rsspodcastindex.org
EMJ PodcastBMJ Group133October 27, 2026Monthlyemjbmj.podbean.comhttp://feeds.bmj.com/emj/podcastspodcastindex.org
Practical Neurology PodcastBMJ Group133October 23, 2026Monthlypnbmj.podbean.comhttp://feeds.bmj.com/pn/podcastspodcastindex.org
eCom Capital PodcastSasha Karabut133October 15, 2026Monthlybuzzsprout.com/1135178https://rss.buzzsprout.com/1135178.rsspodcastindex.org
ABA on TapMike Rubio, BCBA & Dan Lowery, BCBA (co-Hosts) & Suzanne Juzwik, BCBA (Producer)133October 25, 2026Monthlyabaontap.comhttps://rss.buzzsprout.com/783968.rsspodcastindex.org
Foot & Ankle InternationalSAGE, Publications133September 30, 2026Monthlyfai.sagepub.comhttps://rss.libsyn.com/shows/72087/destinations/308309.xmlpodcastindex.org
Wellness and WahalaDr. Tomi-Omo Oba133September 19, 2026Monthlylinktr.ee/Wellnesswahalahttps://anchor.fm/s/100c5854/podcast/rsspodcastindex.org
JAMA Ophthalmology Author InterviewsAmerican Medical Association133October 8, 2026Monthlyjamanetwork.com/journals/jamaophthalmology/pages/jama-ophthalmology-author-interhttps://jamaophthalmologyauthorinterviews.libsyn.com/rsspodcastindex.org
The Photovoltaic PodcastE.N.HUB133October 30, 2026Monthlyconellaholdings.comhttps://rss.buzzsprout.com/562342.rsspodcastindex.org
The Way We RollSimon Minty and Phil Friend133October 30, 2026Monthlythewayweroll.buzzsprout.comhttps://rss.buzzsprout.com/1126850.rsspodcastindex.org
The Future of Insurance: Industry LeadersMajesco133October 22, 2026Monthlymajesco.comhttps://feeds.transistor.fm/the-future-of-insurance-industry-leaderspodcastindex.org
Mental Advantage PodcastJohn Cullen133August 23, 2026Every two weeksspreaker.com/podcast/mental-advantage-podcast--4750777https://www.spreaker.com/show/4750777/episodes/feedpodcastindex.org
The Strength LogDaniel Richter133October 26, 2026Weeklystrengthlog.comhttps://strengthlog.libsyn.com/rsspodcastindex.org
The No Bullsh*t Guide to a Happier LifeGG Calvert133October 20, 2026Every two weekshappier-life.co.uk/category/podcasthttps://happierlife.libsyn.com/rsspodcastindex.org
Post Trauma Secrets & DeclutteringValerie Huard and JM Tetreault133October 27, 2026Every two weeksposttraumasecretsdecluttering.buzzsprout.comhttps://rss.buzzsprout.com/1643110.rsspodcastindex.org
A Mind of Her OwnJennifer Reid, MD133October 29, 2026Every two weeksamindofherown.substack.com/podcastpodcastindex.org
Little ByKristin Oja133October 14, 2026Every two weeksdrkristinoja.comhttps://feeds.resonaterecordings.com/little-bypodcastindex.org
Experts InSightAmerican Academy of Ophthalmology133October 29, 2026Every two weeksaao.org/podcastshttps://aaopodcast.libsyn.com/rsspodcastindex.org
Excellence Above Talent PodcastAaron Thomas133October 30, 2026Every two weeksexcellenceabovetalentpodcast.buzzsprout.comhttps://rss.buzzsprout.com/1865459.rsspodcastindex.org
Be a Better BaddieQuinesha133October 4, 2026Monthlyrss.com/podcasts/qt-with-a-podhttps://media.rss.com/qt-with-a-pod/feed.xmlpodcastindex.org
Love Your GutDr. Heather Finley133October 30, 2026Every two weeksdrheatherfinley.cohttps://rss.buzzsprout.com/1956352.rsspodcastindex.org
The UpLevel PodcastChristie Mann133October 28, 2026Every two weeksuplevelproductions.comhttps://rss.buzzsprout.com/1953728.rsspodcastindex.org
Ahead of the Curve, The Scoliosis ExperienceDr. Meghan Teed, PT, DPT133September 13, 2026Every two weeksthescoliotherapist.com/podcasthttps://rss.buzzsprout.com/2165386.rsspodcastindex.org
Movers and Shakers: a podcast about life with Parkinson'sPodot133October 31, 2026Every two weekstwitter.com/moversand6podcastindex.org
Grief and Light™Nina Rodriguez133October 27, 2026Every two weeksgriefandlight.comhttps://rss.buzzsprout.com/2163685.rsspodcastindex.org
Sex Time StoriesTTMProductions133September 7, 2026Every two weeksspreaker.com/podcast/sex-time-stories--5867880https://www.spreaker.com/show/5867880/episodes/feedpodcastindex.org
Elite Dental PodcastThomas Dooley133October 27, 2026Every two weekssites.libsyn.com/479736https://rss.libsyn.com/shows/479736/destinations/4078764.xmlpodcastindex.org
MyBodyTutorAdam Gilbert and Haley Pulli133October 26, 2026Every two weeksmybodytutor.comhttps://rss.buzzsprout.com/2266750.rsspodcastindex.org
Type 2 Diabetes TalkDr Jedha133October 20, 2026Every two weekstype2diabetestalk.comhttps://rss.buzzsprout.com/2267459.rsspodcastindex.org
Ask The Good DoctorAsk The Good Doctor133October 28, 2026Every two weekshttps://post.futurimedia.com/meanolelion/playlist/rss/58.xmlpodcastindex.org
Single (not spiraling)Lauren133October 23, 2026Weeklyspreaker.com/podcast/single-not-spiraling--6039739https://www.spreaker.com/show/6039739/episodes/feedpodcastindex.org
Radiant RevolutionKim Schaper133October 21, 2026Every two weekspodcasters.spotify.com/pod/show/kim4299https://anchor.fm/s/e99ab750/podcast/rsspodcastindex.org
The Gracie Record PodcastGracie Record133August 8, 2026Weeklyrecordfit.orghttps://rss.buzzsprout.com/2115777.rsspodcastindex.org
Good Grief BelieverGood Grief Believer133October 25, 2026Weeklygoodgriefbeliever.comhttps://anchor.fm/s/ee9af4b8/podcast/rsspodcastindex.org
Trust Your WorthBritney Lavatai133October 24, 2026Weeklytrustyourworth.comhttps://rss.buzzsprout.com/2315221.rsspodcastindex.org
Integrative Women's Health PodcastJessica Drummond133October 27, 2026Weeklyintegrativewomenshealthinstitute.comhttps://feeds.captivate.fm/integrative-womens-health/podcastindex.org
The DNA of Things with Dr. Jeremy KoenigDr. Jeremy Koenig133October 25, 2026Weeklybuzzsprout.com/2294677https://rss.buzzsprout.com/2294677.rsspodcastindex.org
No BS With JoyNo BS With Joy133October 26, 2026Weeklypodcasters.spotify.com/pod/show/nobs-with-joy-britneyhttps://anchor.fm/s/f3aa406c/podcast/rsspodcastindex.org
By Chance AvenueElizabeth Tiglao-Guss133October 27, 2026Weeklybychanceavenue.comhttps://feeds.captivate.fm/by-chance/podcastindex.org
Finding PurposeAdam Vohra133October 27, 2026Weeklysites.libsyn.com/530577https://feeds.libsyn.com/530577/rsspodcastindex.org
BIBLICAL HEALING | Confident, Childhood Trauma, Self-Esteem, Social Anxiety, Guilt, ResentmentMicaiah Gray | Christian Life Coach, Inner-Healing, Mindset Work, Emotional Regulation, Somatic Coach133October 19, 2026Weeklymicaiahgray.comhttps://feed.podbean.com/unitedchristianmarriage/feed.xmlpodcastindex.org
KISC My Health Radio & Stephen LukawskiPeter Mingils133October 30, 2026Weeklyspreaker.com/podcast/kisc-my-health-radio-stephen-lukawski--6542130https://www.spreaker.com/show/6542130/episodes/feedpodcastindex.org

Next 500 shows

Updated November 3, 2026. Read from Podcast Index. Free for any use (the Podcast Index public database). Episode counts and dates are as each show's feed reports them to the Podcast Index. How often a show publishes is the average gap between its first and its latest episode. The index keeps at most 1,000 episodes of a show. Owner names are printed as the feed prints them. Contact addresses are not shown here. Free to reuse with credit to SpecStream under CC BY 4.0. Spot a wrong value? Write to [email protected] with the link to this page.