Skip to the page
Get started free

Data / Podcasts / Fitness / English

Fitness podcasts in English: 28,125 active shows (2026), page 13

28,125 fitness podcasts in English published an episode in the last 90 days to October 31, 2026. 9,780 publish at least weekly and 7,059 published in the last 7 days. The list gives each show's owner, episode count, last episode, publishing frequency, website and feed, read from the Podcast Index on November 3, 2026.

SpecStream is the live web data engine for teams and agents. It reads the Podcast Index every day, and this page is that reading. Ask for the shows you want by topic, language and how often they publish, with each show's contact, and new and changed shows arrive in your sheet, CRM, Slack or agent.

Get fitness podcasts in EnglishWatch for new shows

Active fitness podcasts in English, 6,001 to 6,500

ShowOwnerEpisodesLast episodePublishesWebsiteFeedSource
Parenting UP! Caregiving adventures with comedian J SmilesJ Smiles153October 27, 2026Every two weeksparentingup.buzzsprout.comhttps://rss.buzzsprout.com/1085783.rsspodcastindex.org
The Eat for Endurance PodcastClaire Shorenstein, MS RD CSSD153October 22, 2026Monthlyeatforendurance.com/eatforendurancepodcasthttps://rss.buzzsprout.com/325751.rsspodcastindex.org
Without CompromiseAthletic Brewing Co.153August 20, 2026Monthlyredcircle.com/shows/without-compromise3190https://feeds.redcircle.com/982fe539-7daf-4227-8180-cdac08976351podcastindex.org
The Waiting Room RevolutionHsien Seow and Samantha Winemaker153October 27, 2026Every two weekswaitingroomrev.podbean.comhttps://feed.podbean.com/waitingroomrev/feed.xmlpodcastindex.org
MedCramKyle Allred153September 29, 2026Every two weeksmedcram.comhttps://medcram.libsyn.com/rsspodcastindex.org
Why not meditate?Masako Kozawa153September 30, 2026Every two weekswhynotmeditate.buzzsprout.comhttps://rss.buzzsprout.com/1880981.rsspodcastindex.org
The Barbara Thompson PodcastBarbara Thompson153September 1, 2026Every two weeksselfcarebybarbarathompson.com.auhttps://rss.buzzsprout.com/1959509.rsspodcastindex.org
The Bald Headed Country Boy ShowJesse Wayne Taylor153October 12, 2026Every two weeksredcircle.com/shows/the-bald-headed-country-boy-podcasthttps://feeds.redcircle.com/fd5a1f4a-1b2a-4c44-b52f-feb389f6e183podcastindex.org
DC EKGDC EKG153September 30, 2026Every two weeksstayoncourse.studiohttps://feeds.podetize.com/rss/bwkyLdeHYkpodcastindex.org
The Holistic Goddess PodcastHannah Greig153October 26, 2026Every two weeksnaturallywellbyhannah.comhttps://anchor.fm/s/d939be24/podcast/rsspodcastindex.org
The Complex Trauma PodcastSarah Herstich153October 28, 2026Every two weeksyourcomplextrauma.comhttps://rss.buzzsprout.com/2182785.rsspodcastindex.org
Menopause Rise and Thrive | Helping Women Navigate Midlife and MenopauseDr. Sara Poldmae | Healer, Doctor of Acupuncture and Chinese medicine, and Functional Medicine Practitioner153October 22, 2026Every two weeksrisingwomanproject.comhttps://rss.buzzsprout.com/2170963.rsspodcastindex.org
Headfirst: A Concussion PodcastDr Reece Granger BSc (Hons), BChiro153October 27, 2026Every two weeksheadfirstaconcussionpodcast.buzzsprout.comhttps://rss.buzzsprout.com/2171297.rsspodcastindex.org
Live Your True SelfNemisha Patel Owen153October 23, 2026Every two weeksnemishapatelowen.com/podcasts/live-your-true-selfhttps://app.kajabi.com/podcasts/2147512339/feedpodcastindex.org
The Primal ShiftMK Media Group153September 11, 2026Weeklyprimalshiftpodcast.comhttps://feeds.libsyn.com/479832/rsspodcastindex.org
Libido LoungeDr. Diane Mueller s153October 29, 2026Weeklymylibidodoc.com/podcastshttps://feeds.podcastai.com/3ktYr7qGYpjzq0gTtlxqmE.xmlpodcastindex.org
Inner Peace and PowerRashmi Schramm, MD153October 26, 2026Weeklyrashmischramm.comhttps://rss.buzzsprout.com/2270762.rsspodcastindex.org
Achieve Your ApexChad Hyams153October 28, 2026Weeklychadhyams.comhttps://rss.libsyn.com/shows/492797/destinations/4210361.xmlpodcastindex.org
POS PodcastsLance and Matt153October 27, 2026Weeklyzencastr.com/POS-Podcastshttps://feeds.zencastr.com/f/G7GU0w-x.rsspodcastindex.org
TransformDear Media153October 28, 2026Weeklyart19.com/shows/transformhttps://rss.art19.com/transformpodcastindex.org
Jokes and the Gym with Rudy TyburczyRudy Tyburczy153October 27, 2026Weeklybuzzsprout.com/2295801https://rss.buzzsprout.com/2295801.rsspodcastindex.org
Best Of ThreeBest Of Three Productions153October 28, 2026Weeklybestofthreeproductions.comhttps://rss.buzzsprout.com/2422993.rsspodcastindex.org
Voices in Health and WellnessDr Andrew Greenland153October 25, 2026Weeklyvoicesinhealthandwellness.comhttps://rss.buzzsprout.com/2489689.rsspodcastindex.org
Awakened Living with NibodhiNibodhi153October 27, 2026Several times a weeknibodhi.com/podcasts/awakened-living-with-nibodhihttps://app.kajabi.com/podcasts/2147965852/feedpodcastindex.org
The Pattern RecognizerDan Desmarques153October 31, 2026Dailyspreaker.com/podcast/the-pattern-recognizer--7016687https://www.spreaker.com/show/7016687/episodes/feedpodcastindex.org
Mario's PlaceMario Ledesma153October 31, 2026Dailylinktr.ee/mblcalihttps://feeds.captivate.fm/marios-place/podcastindex.org
Staying Up with Cammie and TarynCloud10153October 28, 2026Every two weekshttps://feeds.megaphone.fm/CTL8095060808podcastindex.org
Choose the Hard WayAndrew Vontz152October 28, 2026Monthlychoosethehardway.comhttps://choosethehardway.libsyn.com/rsspodcastindex.org
CannMed Coffee TalkMedicinal Genomics152September 23, 2026Every two weekscannmedevents.comhttps://cannmedevents.com/feed/podcast/?redirect=nopodcastindex.org
Addiction AudioRob Calder152October 30, 2026Every two weeksaddictionjournal.orghttps://feeds.acast.com/public/shows/addiction-audiopodcastindex.org
MedAxiom HeartTalkCandice Reineke152October 7, 2026Monthlymedaxiom.com/hearttalkhttps://www.spreaker.com/show/3081506/episodes/feedpodcastindex.org
Everyday Ayurveda and Yoga at Hale PuleMyra Lewin at Hale Pule School of Ayurveda and Yoga152October 2, 2026Monthlyhalepule.comhttps://rss.buzzsprout.com/39107.rsspodcastindex.org
Ask Doctor DawnDr. Dawn Motyka152October 30, 2026Every two weeksjivamedia.com/askdrdawn/askdrdawn.phphttps://askdrdawn.com/audio/dawn.xmlpodcastindex.org
The AppetiteThe Appetite152October 6, 2026Monthlyopalfoodandbody.comhttps://theappetite.libsyn.com/rsspodcastindex.org
The Mindset CoachLara Young152October 9, 2026Every two weeksthe-mindset-coach.captivate.fmhttps://feeds.captivate.fm/the-mindset-coach/podcastindex.org
Thinking About Ob/GynAntonia Roberts and Howard Herrell152October 28, 2026Every two weeksbuzzsprout.com/1513069https://rss.buzzsprout.com/1513069.rsspodcastindex.org
The Tenacity PodcastFergus Crawley152October 18, 2026Every two weeksthemodernmind.buzzsprout.comhttps://rss.buzzsprout.com/1660573.rsspodcastindex.org
Saying it outloud!Leonardo&Stephanie152October 22, 2026Every two weeksbuzzsprout.com/1772817https://rss.buzzsprout.com/1772817.rsspodcastindex.org
Growing Up with Dr. SarahDr Sarah Adams152October 15, 2026Every two weeksredcircle.com/shows/growing-up-with-dr-sarahhttps://feeds.redcircle.com/4702ad26-ff4c-4dd0-90f4-e53d7672f201podcastindex.org
Schooling StruggleSchooling Struggle152October 31, 2026Every two weekspodcasters.spotify.com/pod/show/peter-driscollhttps://anchor.fm/s/704ae4b0/podcast/rsspodcastindex.org
The Melanin Wellness Podcast: Mental Health, Nervous System Care & Healing for Black WomenCorinna Dunn152October 28, 2026Every two weeksspreaker.com/podcast/the-melanin-wellness-podcast-mental-health-nervous-system-chttps://www.spreaker.com/show/7011969/episodes/feedpodcastindex.org
Health ChatterClarence and Stan152October 23, 2026Every two weeksrss.com/podcasts/healthchatterhttps://media.rss.com/healthchatter/feed.xmlpodcastindex.org
Unbreakable LatinaUnbreakable Latina LLC152October 26, 2026Every two weeksunbreakablelatina.compodcastindex.org
Encountering YouK-LOVE Podcasts152October 21, 2026Every two weekspodcasts.klove.com/pd/Encountering-Youhttps://podcasts.klove.com/podcast?categoryID2=178podcastindex.org
The Huddle Wisdom Podcast with Dr Davin TanDr Davin Tan is a child and adolescent psychiatrist and parent.152August 31, 2026Every two weekshuddlewisdom.com/podcasts/the-huddle-wisdom-podcast-with-dr-davin-tanhttps://app.kajabi.com/podcasts/2147496230/feedpodcastindex.org
Teesche PodcastTim Teege152October 14, 2026Every two weeksteesche.com/podcasthttps://www.teesche.com/podcast/feedpodcastindex.org
The Frontline Herbalism PodcastSolidarity Apothecary152October 11, 2026Every two weekssolidarityapothecary.orghttps://feeds.captivate.fm/frontline-herbalism-podcast/podcastindex.org
We Need To Talk with Toni StreetNZME152October 18, 2026Every two weeksthecoast.net.nzhttps://www.omnycontent.com/d/playlist/7784f840-c291-422a-924b-ad9000bbad71/02b5c6ad-8b4f-4789-a3c1-aea20014e85e/9d5d1ba6-0e8b-4b34-a5ec-aea200166acf/podcast.rsspodcastindex.org
The Pilates Goddess PodcastLynda Lippin152October 22, 2026Every two weeksbleav.com/shows/the-pilates-goddess-podcasthttps://feeds.simplecast.com/F2jPldMypodcastindex.org
Yoga Nidra & Beyond | Ayla NovaAyla Nova152September 10, 2026Every two weeksaylanova.comhttps://www.spreaker.com/show/5641302/episodes/feedpodcastindex.org
School of Self-WorthNicole Tsong152October 21, 2026Every two weeksbuzzsprout.com/2129667https://rss.buzzsprout.com/2129667.rsspodcastindex.org
How To Be WellnStrongJacqueline Genova152October 27, 2026Every two weekswellnstrong.comhttps://rss.buzzsprout.com/2117017.rsspodcastindex.org
What I Wish I Knew beyond Pregnancy LossSharna Southan152October 25, 2026Every two weekssharnasouthan.com/podcasts/what-i-wish-i-knew-beyond-pregnancy-losshttps://app.kajabi.com/podcasts/2147789028/feedpodcastindex.org
Another Triathlon PodcastJenna-Caer152October 21, 2026Every two weeksanothertriathlonpodcast.buzzsprout.comhttps://rss.buzzsprout.com/2192315.rsspodcastindex.org
Type 1 Tribe: a Type 1 Diabetes PodcastSamantha Hildebrandt152September 5, 2026Every two weekstype1tribe.comhttps://anchor.fm/s/c71f3cf0/podcast/rsspodcastindex.org
The Kaya Ramjee ShowKaya Ramjee152October 29, 2026Every two weekskayaramjee.comhttps://feeds.captivate.fm/thekayaramjeeshow/podcastindex.org
The Healthy, Real Food®️ Podcast with Erin Hart, BSN, RNErin Hart152October 26, 2026Weeklyerinharthealthcoaching.buzzsprout.comhttps://podcasts.helloaudio.fm/podcast/0e0026ad-a52b-49d0-a4be-43e9573cfac1/WFhSQ0dr6cpodcastindex.org
ILL-EGO Culture Brands Red Tape Talk "Something About Everything"John Ostos152October 30, 2026Weeklyrss.com/podcasts/redtapetalkhttps://media.rss.com/redtapetalk/feed.xmlpodcastindex.org
Press Pause PodcastKatrina & Lauren152October 26, 2026Weeklybuzzsprout.com/2196053https://rss.buzzsprout.com/2196053.rsspodcastindex.org
Choose the Hard WayAndrew Vontz152October 28, 2026Monthlychoosethehardway.comhttps://rss.libsyn.com/shows/139580/destinations/872954.xmlpodcastindex.org
The Lipoedema PodcastShell and Tiana152October 28, 2026Weeklypodcasters.spotify.com/pod/show/thelipoedemapodcasthttps://anchor.fm/s/e4336604/podcast/rsspodcastindex.org
The Verdict with the Catastrophic Injury Lawyer Clarke SpeaksClarke Speaks152September 10, 2026Weeklyspeakslaw.comhttps://rss.buzzsprout.com/2239802.rsspodcastindex.org
The Midlife GraceGinger Monceaux152October 27, 2026Weeklythe-midlife-grace.captivate.fmhttps://feeds.captivate.fm/the-midlife-grace/podcastindex.org
The Athlete's CompassAthletica152October 29, 2026Weeklyathletica.ai/the-athletes-compass-podcasthttps://feeds.captivate.fm/the-athletes-compass/podcastindex.org
Sunshine Café: Stories to Encourage & InspireLisa Roers152October 31, 2026Weeklylisaroers.com/podcasts/sunshine-cafe-stories-to-encourage-inspirehttps://app.kajabi.com/podcasts/2147677264/feedpodcastindex.org
Source HarmonyPsychology with Hanieh152September 23, 2026Weeklypodcasters.spotify.com/pod/show/haniehpsychologyhttps://anchor.fm/s/c59176dc/podcast/rsspodcastindex.org
There's an OT for That!There's an OT for That!152October 30, 2026Weeklycarelabpodcast.comhttps://anchor.fm/s/102b7dc40/podcast/rsspodcastindex.org
Wet & Worthy Woman with The Wild FemThe Wild Fem152October 29, 2026Weeklythewildfem.comhttps://anchor.fm/s/eafa70b8/podcast/rsspodcastindex.org
Insight: The Stripped Back PodcastStephen Buckley and Keith Delahan152October 24, 2026Weeklyspreaker.com/podcast/insight-the-stripped-back-podcast--6117564https://www.spreaker.com/show/6117564/episodes/feedpodcastindex.org
Adversity to Strength with Lee FreemanLee Freeman152October 29, 2026Weeklyadversitytostrength.comhttps://anchor.fm/s/104336c9c/podcast/rsspodcastindex.org
Restful RainbowDucky Media152October 31, 2026Several times a weekrestful-rainbow.captivate.fm/supporthttps://feeds.captivate.fm/restful-rainbow/podcastindex.org
Living with FASDPatricia Kasper152October 26, 2026Every two weekspatriciakasper.comhttps://api.riverside.fm/hosting/cTy7jkjD.rsspodcastindex.org
Breaking Up With Binge EatingGeorgie Fear151August 17, 2026Monthlyconfidenteaters.comhttps://feeds.transistor.fm/breaking-up-with-binge-eatingpodcastindex.org
The Movement System PodcastMatthew Casturo151October 28, 2026Monthlythemovementsystem.comhttps://themovementsystem.libsyn.com/rsspodcastindex.org
JDD Podcast: Ask the InvestigatorJDD Podcast: Ask the Investigator151October 2, 2026Monthlyjddonline.comhttps://jddonline.com/feed/podcast/podcastindex.org
The Soulful EclecticDr. Diana Collins151September 26, 2026Every two weeksthesoulfuleclectic.comhttps://media.rss.com/thesoulfuleclectic/feed.xmlpodcastindex.org
The Weekly REBOOTREBOOT Recovery151October 26, 2026Monthlyrebootrecovery.comhttps://therebootrecoveryshow.libsyn.com/rsspodcastindex.org
Healthy Wealthy Wise Artist PodcastLara Bianca Pilcher151October 27, 2026Every two weekslarabiancapilcher.com/podcasthttps://feeds.captivate.fm/healthywealthywiseartistpodcast/podcastindex.org
KarateBuilt Martial ArtsGreg Moody151October 13, 2026Every two weekskaratebuilt.com/podcastshttps://karatebuilt.com/feed/podcasts/podcastindex.org
The Modern Fairy Sightings PodcastSpectreVision Radio151October 28, 2026Every two weeksscarlettofthefae.comhttps://feeds.megaphone.fm/PHTE1373658408podcastindex.org
Align Your MindChelsea Tanner151October 26, 2026Every two weeksalignyourmindpodcast.comhttps://rss.buzzsprout.com/1423189.rsspodcastindex.org
Still Listening "Where Deep Listening Becomes Lived Wisdom"Rob Cook151September 12, 2026Every two weeksredcircle.com/shows/still-listeninghttps://feeds.redcircle.com/2473d3b8-6149-4478-93db-ae002bb484a6podcastindex.org
Humanity WorkingHumanity Working151October 29, 2026Every two weekshumanityworking.nethttps://rss.buzzsprout.com/1716393.rsspodcastindex.org
Ancestral KitchenAlison Kay & Andrea Huehnerhoff151October 19, 2026Every two weeksancestralkitchenpodcast.comhttps://feeds.captivate.fm/ancestralkitchen/podcastindex.org
Just DeW ItDental Entrepreneur Women151October 14, 2026Every two weeksdewlifecrew.com/podcasts/just-dew-ithttps://app.kajabi.com/podcasts/2147486408/feedpodcastindex.org
Bikini PodcastTroy Thornton151September 25, 2026Every two weekspodcasters.spotify.com/pod/show/troy-thornton7https://anchor.fm/s/2e40b89c/podcast/rsspodcastindex.org
Living Longer Better SmarterMary Furlong & Fred Fishkin151October 29, 2026Every two weeksmaryfurlong.com/podcasthttps://anchor.fm/s/341846b8/podcast/rsspodcastindex.org
Beautifully Unbalanced PodcastMikita Smith, #SelfCare #Motivation #WellnessJourney #BeautifullyUnbalanced151August 11, 2026Every two weeksbeautifully-unbalanced.com/thyme-4-teahttps://rss.buzzsprout.com/1787178.rsspodcastindex.org
ID:IOTS - Infectious Disease Insight Of Two SpecialistsInfectious Disease: Insights of Two Specialists151October 26, 2026Every two weeksidiotspodcasting.buzzsprout.comhttps://rss.buzzsprout.com/1782416.rsspodcastindex.org
Never Been SickerMichael Rubino151October 28, 2026Every two weeksneverbeensicker.buzzsprout.comhttps://rss.buzzsprout.com/1839431.rsspodcastindex.org
Shoulders DownLeah Kern151October 5, 2026Every two weeksleahkernrd.comhttps://rss.buzzsprout.com/1961653.rsspodcastindex.org
This Week in Surgery CentersThis Week In Surgery Centers151October 20, 2026Every two weekshstpathways.comhttps://feeds.zencastr.com/f/7hE5uOy7.rsspodcastindex.org
Sleep Time: Sleep Meditations with Nicky SuttonNicky Sutton151October 26, 2026Every two weeksnickysutton.compodcastindex.org
The NatureCity PodcastNature City151October 16, 2026Every two weeksnature-city-podcast.captivate.fmhttps://feeds.captivate.fm/nature-city-podcast/podcastindex.org
Simply SophSophia Rudy151October 30, 2026Every two weekssimplysophpodcast.buzzsprout.comhttps://rss.buzzsprout.com/2135151.rsspodcastindex.org
The Liquid Green Health ShowThe Liquid Green Health Show151October 26, 2026Every two weekspodcasters.spotify.com/pod/show/liquid-green-health-showhttps://anchor.fm/s/807acfa8/podcast/rsspodcastindex.org
The Scrumptious WomanJuliette Karaman151October 30, 2026Every two weeksfeelfullyyou.comhttps://rss.buzzsprout.com/2208024.rsspodcastindex.org
Iron bEAuty PodcastElizabeth Aylor Fitness151October 30, 2026Every two weeksbuzzsprout.com/2216440https://rss.buzzsprout.com/2216440.rsspodcastindex.org
Hot Mess EspressoHeather Herington151October 28, 2026Every two weekshotmessespressopod.riverside.comhttps://api.riverside.fm/hosting/MWxiFze4.rsspodcastindex.org
Heaven on Earth Mini MeditationsChristopher Sell151October 28, 2026Weeklyheaven-on-earth.co.ukhttps://rss.buzzsprout.com/2230613.rsspodcastindex.org
Rhesus Medicine Podcast - Medical EducationDr Rhys Welnitschuk151October 26, 2026Weeklyyoutube.com/rhesusmedicinehttps://rss.buzzsprout.com/2269513.rsspodcastindex.org
Superhumanistic Health & WellnessDavid & Jessica151October 31, 2026Weeklyrss.com/podcasts/physical-benefits-of-yogahttps://media.rss.com/physical-benefits-of-yoga/feed.xmlpodcastindex.org
Where Women Win with Sarah FechterSarah Fechter151October 26, 2026Weeklylinktr.ee/sarahfechterifbbhttps://feeds.libsyn.com/498948/rsspodcastindex.org
Weight Loss And ...Holly Wyatt & James Hill151October 28, 2026Weeklyweightlossand.comhttps://feeds.transistor.fm/weight-loss-andpodcastindex.org
The Healthcare LabyrinthMarc S. Ryan151October 30, 2026Weeklyhealthcarelabyrinth.comhttps://feeds.libsyn.com/498763/rsspodcastindex.org
Health Is A Skill with Todd Vande HeiTodd Vande Hei151October 27, 2026Weeklymissionmatters.com/author/todd-vande-heihttps://podesis.com/feed/health-is-a-skill-with-todd-vande-heipodcastindex.org
Lipedema Mamas PodcastAshley Fisher & Shawn Bigby151October 26, 2026Every two weekspodcasters.spotify.com/pod/show/ashley-fisher4https://anchor.fm/s/dedbebcc/podcast/rsspodcastindex.org
Best Health PositivelyKrista Noviski151October 26, 2026Weeklybesthealthpositively.buzzsprout.comhttps://rss.buzzsprout.com/2451052.rsspodcastindex.org
Desire DialoguesSex Coach Lauren Nicole | LNG coaching151October 11, 2026Weeklylinktr.ee/relationshipcoachlaurengoyettehttps://anchor.fm/s/c4793bcc/podcast/rsspodcastindex.org
Original Poetry Rootz PodcastOriginal Poetree151October 26, 2026Several times a weekoriginalpoetree.substack.com/podcastpodcastindex.org
All Things Love and Intimacy with Katie ZiskindKatie Ziskind, MFT, LMFT, CSTIP, RYT500151October 22, 2026Weeklywisdomwithinct.comhttps://anchor.fm/s/f0655220/podcast/rsspodcastindex.org
Jung Chicago RadioC. G. Jung Institute of Chicago151October 19, 2026Monthlyjungchicago.orghttps://jungchicago.org/feed/podcast/podcastindex.org
UK HealthCastUK HealthCare150October 16, 2026Monthlyukhealthcare.uky.edu/podcastshttps://support.doctorpodcasting.com/podcastfeed/243podcastindex.org
SHSMD Podcast Rapid Insights for Health Care Marketers, Planners, and CommunicatorsSociety for Healthcare Strategy & Market Development150October 30, 2026Every two weeksshsmd.org/education/podcasthttps://support.doctorpodcasting.com/podcastfeed/278podcastindex.org
Diva Tonight with Carlene HumphreyCarlene Humphrey150October 29, 2026Every two weeksdivatonight.buzzsprout.comhttps://rss.buzzsprout.com/1039483.rsspodcastindex.org
HERHER150October 29, 2026Every two weeksradiomd.com/show/herhttp://feeds.feedburner.com/RadioMD/HerRadiopodcastindex.org
SpeakUpJVSpeakUpJV with Vernisa150September 25, 2026Every two weeksspeakupjv.podbean.comhttps://speakupjv.podbean.com/feed.xmlpodcastindex.org
Self Talk with Rachel AstarteRachel Astarte, LMFT150October 6, 2026Monthlyrachelastartetherapy.com/podcasthttps://rss.buzzsprout.com/268241.rsspodcastindex.org
Alopecia LifeHost: Deeann Graham150October 22, 2026Monthlyalopecialife.com/podcasthttps://rss.buzzsprout.com/572254.rsspodcastindex.org
To Your Good HealthTo Your Good Health150October 29, 2026Every two weeksradiomd.com/show/to-your-good-health-radiohttp://feeds.feedburner.com/RadioMD/ToYourGoodHealthRadiopodcastindex.org
YOU: The Owner's ManualYOU: The Owner's Manual150October 27, 2026Weeklyradiomd.com/show/you-the-owners-manual-radio-showhttp://feeds.feedburner.com/RadioMD/YouTheOwnersManualpodcastindex.org
Shaping Freedom With Lisane BasquiatShaping Freedom150October 27, 2026Monthlyhttps://feeds.megaphone.fm/SHML5393053211podcastindex.org
Live Greater | A University of Maryland Medical System PodcastUniversity of Maryland Medical System150October 20, 2026Every two weeksumms.org/podcasthttps://support.doctorpodcasting.com/podcastfeed/216podcastindex.org
It's Your Health RadioHenry Mayo Newhall150October 30, 2026Every two weekshenrymayo.com/news-publications/publications/your-health-podcasthttps://support.doctorpodcasting.com/podcastfeed/268podcastindex.org
Better Edge : A Northwestern Medicine podcast for physiciansNorthwestern Medicine150October 9, 2026Weeklyphysicianpodcasts.nm.orghttp://feeds.feedburner.com/BetterEdgepodcastindex.org
PEM Currents: The Pediatric Emergency Medicine PodcastBrad Sobolewski, MD, MEd150October 19, 2026Monthlypemcurrents.comhttps://www.pemcurrents.com/feed.xmlpodcastindex.org
King of the RideTed King150October 26, 2026Monthlyiamtedking.podbean.comhttps://feed.podbean.com/iamtedking/feed.xmlpodcastindex.org
Franciscan Health Doc PodFranciscan Health150September 30, 2026Every two weeksfranciscanhealth.org/podcastshttp://feeds.feedburner.com/FranciscanHealthDocPodpodcastindex.org
SLP Full DisclosureAMN Healthcare150October 27, 2026Monthlyamnhealthcare.com/podcast/slp-full-disclosurehttps://feeds.simplecast.com/0Z0aoA1qpodcastindex.org
Pursuing Private PracticeJennifer McGurk150October 27, 2026Monthlypursuingprivatepractice.comhttps://pursuingprivatepractice.libsyn.com/rsspodcastindex.org
Salinas Valley Health Ask The Experts PodcastSalinas Valley Health150October 12, 2026Every two weekssvmh.com/patients-visitors/ask-the-experts-podcasthttp://feeds.feedburner.com/SVMHSAskTheExpertsPodcastpodcastindex.org
Forever White BeltAdolfo Foronda150October 6, 2026Every two weeksforeverwhitebelt.comhttps://anchor.fm/s/29ed1bc8/podcast/rsspodcastindex.org
Krush PerformanceJeff Krushell150October 28, 2026Every two weeksradioinfluence.com/category/krush-performancehttps://radioinfluence.com/category/krush-performance/feed/podcastindex.org
Pray Every DayMary DeMuth150October 31, 2026Dailymarydemuth.com/category/pray-every-day-podcasthttp://feeds.feedburner.com/PrayEveryDaypodcastindex.org
Academic Medicine PodcastAcademic Medicine150October 19, 2026Every two weeksacademicmedicinepodcast.libsyn.com/websitehttps://academicmedicinepodcast.libsyn.com/rsspodcastindex.org
Parrish The ThoughtBrian Keith Parrish150October 9, 2026Every two weeksparrishpodcast.podbean.comhttps://feed.podbean.com/parrishpodcast/feed.xmlpodcastindex.org
LifeSpa: Ayurveda Meets Modern ScienceDr. John Douillard, DC, CAP150September 3, 2026Monthlylifespa.com/podcasthttp://feeds.feedburner.com/lifespa-podcastspodcastindex.org
The Love Cast with JamalJamal Jivanjee150October 29, 2026Monthlyjamaljivanjee.com/life-coachinghttps://thelovecast.libsyn.com/rsspodcastindex.org
Clarity Within: Overthinking, Self-Doubt & Feeling StuckRussell Davis | Executive Coach and Therapist150October 27, 2026Weeklythefertilemind.podbean.comhttps://feed.podbean.com/thefertilemind/feed.xmlpodcastindex.org
The MKT ShowThe MKT Network150October 30, 2026Every two weeksthemktshow.comhttps://iono.fm/rss/chan/7149podcastindex.org
Medical Matters with Sulaiman Essop - Every Wednesday 20:00-21:00Markaz Sahaba Online Radio150October 28, 2026Every two weeksmarkazsahaba.comhttps://iono.fm/rss/chan/4067podcastindex.org
ZiFM Stereo Current AffairsZiFM Stereo150October 26, 2026Dailyzifmstereo.co.zwhttps://iono.fm/rss/chan/3902podcastindex.org
GET UP & GO BREAKFAST - DR WENDY CHRISTIENCape Pulpit / Kaapse Kansel150October 29, 2026Every two weekscapepulpit.co.zahttps://iono.fm/rss/chan/5230podcastindex.org
Kaycee RossouwAlgoa FM150October 29, 2026Weeklyalgoafm.co.zahttps://iono.fm/rss/chan/5861podcastindex.org
Still Parents Podcast ®Still Parents Podcast150October 13, 2026Every two weeksstillparentspodcast.co.ukhttps://audioboom.com/channels/5042625.rsspodcastindex.org
What Kind of Asian Are You?DIASPORA ASIAN PRODUCTIONS150October 1, 2026Every two weekswhatkindofasianareyou.buzzsprout.comhttps://rss.buzzsprout.com/1791323.rsspodcastindex.org
The Science of Self-HealingThe Bioregulatory Medicine Institute150October 20, 2026Every two weeksthescienceofselfhealing.libsyn.com/sitehttps://thescienceofselfhealing.libsyn.com/rsspodcastindex.org
The New Era Woman NetworkERC150October 18, 2026Every two weeksnewerawoman.orghttps://www.spreaker.com/show/4771294/episodes/feedpodcastindex.org
LX2 Codependency CoachingS Aschenbrenner150October 24, 2026Weeklyx2thexennial.podbean.com/1.0https://feed.podbean.com/x2thexennial/feed.xmlpodcastindex.org
Steady State PodcastSteady State Network150October 10, 2026Every two weekssteadystatenetwork.podbean.comhttps://feed.podbean.com/steadystatenetwork/feed.xmlpodcastindex.org
Besties with Breasties PodcastBesties with Breasties Podcast150October 28, 2026Every two weeksbestieswithbreastiespodcast.comhttps://feeds.captivate.fm/bestieswithbreasties/podcastindex.org
Aging With GraceDG Linton Gridley150October 25, 2026Every two weeksbuzzsprout.com/1770592https://rss.buzzsprout.com/1770592.rsspodcastindex.org
Flourish- A Prisma Health PodcastPRISMA Health150October 27, 2026Monthlypodcast.prismahealth.orghttp://feeds.feedburner.com/flourish-aprismahealthpodcastpodcastindex.org
The Broke Girl Society PodcastChristina Cook - The Broke Girl Society150October 19, 2026Every two weeksthebrokegirlsociety.comhttps://anchor.fm/s/597e6c5c/podcast/rsspodcastindex.org
What The FertilityAmanda Bristow and Catherine Baker150August 31, 2026Every two weekswhatthefertilitypod.comhttps://feeds.blubrry.com/feeds/whatthefertility.xmlpodcastindex.org
The Relaxback UK ShowMike Dilke150October 28, 2026Weeklyrelaxbackuk.podbean.comhttps://relaxbackuk.podbean.com/feed.xmlpodcastindex.org
Fat Joy with Sophia ApostolSophia Apostol150September 27, 2026Every two weeksfatjoy.lifehttps://media.rss.com/fatjoy/feed.xmlpodcastindex.org
What Would Dr. Meyers Do?What Would Dr. Meyers Do?150October 20, 2026Every two weeksamymeyersphd.orghttps://anchor.fm/s/ac551d40/podcast/rsspodcastindex.org
Psychology TalksAmbreen Nadeem Nadeem150October 25, 2026Every two weekspodcasters.spotify.com/pod/show/ambreen-nadeem-nadeemhttps://anchor.fm/s/76854a50/podcast/rsspodcastindex.org
Threshold MomentsSarah Tacy150October 27, 2026Every two weekssites.libsyn.com/456447https://feeds.libsyn.com/456447/rsspodcastindex.org
HSE Talking Health and WellbeingHSE150October 28, 2026Every two weekshsepodcasts.podbean.comhttps://hsepodcasts.podbean.com/feed.xmlpodcastindex.org
HSE Talking Health and WellbeingHSE150October 28, 2026Every two weekshsepodcasts.podbean.comhttps://feed.podbean.com/hsepodcasts/feed.xmlpodcastindex.org
Healthy Beyond 40 | Lose Weight, Healthier Habits, Reduce Stress, Feel Confident, Mindset, More Energy, Feel Better, Emotional EatingMichele Riechman | Online Personal Trainer, Health Coach, Yoga Teacher150October 26, 2026Weeklymicheleriechman.podbean.comhttps://micheleriechman.podbean.com/feed.xmlpodcastindex.org
Healthy Beyond 40 | Lose Weight, Healthier Habits, Reduce Stress, Feel Confident, Mindset, More Energy, Feel Better, Emotional EatingMichele Riechman | Online Personal Trainer, Health Coach, Yoga Teacher150October 26, 2026Weeklymicheleriechman.podbean.comhttps://feed.podbean.com/micheleriechman/feed.xmlpodcastindex.org
Clinical UpdateHaymarket Media Group Ltd150October 21, 2026Every two weeksshows.acast.com/clinical-updatepodcastindex.org
Finding New WatersFinding New Waters150October 29, 2026Every two weeksfindingnewwaters.comhttps://anchor.fm/s/dfb6a974/podcast/rsspodcastindex.org
The Audible Local Ledger Reads to the BlindAudible Local Ledger150October 31, 2026Dailyaudiblelocalledger.podbean.comhttps://feed.podbean.com/audiblelocalledger/feed.xmlpodcastindex.org
Mom, What's For Dinner?Jen Belanger MS RD LDN and Izzy Wilson150October 27, 2026Every two weeksjenbelangernutrition.comhttps://rss.buzzsprout.com/2202632.rsspodcastindex.org
Nurses Uncorked - A Nursing Podcast Delivering Nursing NewsNurse Erica150October 26, 2026Weeklynursesuncorked.comhttps://feed.podbean.com/thenurseericarn/feed.xmlpodcastindex.org
OSU MedNet21150October 30, 2026Every two weekspodcast.osu.edu/osumednet21https://podcast.osu.edu/osumednet21/feed/podcast/podcastindex.org
белый шум для сна и концентрациибелый шум для сна150October 4, 2026Weeklysleepru.podbean.comhttps://feed.podbean.com/sleepru/feed.xmlpodcastindex.org
PL DEN | The Powerlifter's DenCam Smith150October 28, 2026Every two weeksplden.comhttps://anchor.fm/s/e2a48ee4/podcast/rsspodcastindex.org
The PCC PodcastMarissa Chong150October 26, 2026Weeklypodcasters.spotify.com/pod/show/marissa-chonghttps://anchor.fm/s/e7a90208/podcast/rsspodcastindex.org
The Disappearing Mind PodcastSenior Living Near Me150October 30, 2026Weeklythedisappearingmind.comhttps://media.rss.com/thedisappearingmind/feed.xmlpodcastindex.org
Diet Starts Monday PodcastRoscoe Carter-Johnson150October 29, 2026Weeklypodcasters.spotify.com/pod/show/dietstartsmondayhttps://anchor.fm/s/e80c54fc/podcast/rsspodcastindex.org
Somatic Healing MeditationsKarena Neukirchner150October 30, 2026Weeklybleav.com/shows/somatic-healing-meditationshttps://feeds.simplecast.com/7Lara3EQpodcastindex.org
We Need To Talk with Dr. Darcy SterlingDr. Darcy Sterling150October 27, 2026Weeklyopen.spotify.com/show/63IoJN1pOn957p2pghBcLXhttps://anchor.fm/s/108621f70/podcast/rsspodcastindex.org
The Nutrition NurseAnna Harris150October 25, 2026Weeklythenutritionnurse.co.ukhttps://anchor.fm/s/ef2ed23c/podcast/rsspodcastindex.org
An Incomplete Guide to Personal GrowthKelly Arrendell and Sydney Arrendell150October 27, 2026Weeklyanincompleteguide.comhttps://feeds.captivate.fm/an-incomplete-guide-to/podcastindex.org
Next-Level You PodcastStefanie Dingbaum LISW CCHt150October 30, 2026Weeklywaveshealingtherapy.comhttps://rss.buzzsprout.com/2330918.rsspodcastindex.org
Long COVID Real Talk PodcastKatherine Marie150October 30, 2026Weeklylongcovidrealtalk.comhttps://anchor.fm/s/f3cb4e88/podcast/rsspodcastindex.org
Mobilize And EnergizeDr. Tammy Penhollow150October 30, 2026Weeklymobilize-and-energize.captivate.fmhttps://feeds.captivate.fm/mobilize-and-energize/podcastindex.org
The Last Post Radio ShowGreg T Ross150October 30, 2026Several times a weekmynewpodcast.captivate.fmhttps://feeds.captivate.fm/mynewpodcast/podcastindex.org
The Health PulseQuick Lab Mobile150October 5, 2026Weeklyquicklabmobile.comhttps://rss.buzzsprout.com/2455938.rsspodcastindex.org
Bounce Back, Black Woman! | Healing, Personal Growth, & ResilienceDel Smith, M.S. | Coach, Author & Speaker helping women heal, rebuild, and live more intentionally.150October 30, 2026Weeklybouncebackblackwoman.comhttps://feed.podbean.com/bouncebackblackwoman/feed.xmlpodcastindex.org
The Surgical EdgeSurgical Doctor150October 23, 2026Several times a weekbuzzsprout.com/2515307https://rss.buzzsprout.com/2515307.rsspodcastindex.org
The MAHA ReportMAHA™ Action150September 11, 2026Weeklythemahareport.comhttps://rss.buzzsprout.com/2567509.rsspodcastindex.org
The Stoic BlueprintThe Stoic Blueprint150August 18, 2026Dailyspreaker.com/podcast/the-stoic-blueprint--6905978https://www.spreaker.com/show/6905978/episodes/feedpodcastindex.org
Magic SeedsLaura R. Gries150October 28, 2026Every two weekslaurakarch11.podbean.comhttps://feed.podbean.com/laurakarch11/feed.xmlpodcastindex.org
The Relaxback UK ShowMike Dilke150October 28, 2026Weeklyrelaxbackuk.podbean.comhttps://feed.podbean.com/relaxbackuk/feed.xmlpodcastindex.org
BorderlinerNotes: Real Therapy SessionsBorderlinerNotes150October 31, 2026All episodes at onceyoutube.com/@borderlinernoteshttps://feeds.megaphone.fm/borderlinernotes-real-therapy-sessionspodcastindex.org
One Thing with Dr. Adam RindeDr. Adam Rinde150October 30, 2026Monthlysoundintegrative.comhttps://feeds.captivate.fm/one-thing-with-dr-adam/podcastindex.org
Thinking NutritionDr Tim Crowe149September 14, 2026Monthlythinkingnutrition.com.auhttps://rss.buzzsprout.com/808853.rsspodcastindex.org
Feed Your Soul with KimKim McLaughlin149October 26, 2026Monthlyspreaker.com/show/feed-your-soul-with-kimhttps://rss.buzzsprout.com/1056343.rsspodcastindex.org
NOURISH: Women Over 30Julie Booher149October 5, 2026Monthlyjuliebooher.comhttps://rss.buzzsprout.com/1828758.rsspodcastindex.org
Worldchefs Podcast: World on a PlateWorldchefs149October 20, 2026Monthlylatest.worldchefs.org/podcastshttps://worldchefs.libsyn.com/rsspodcastindex.org
Health Innovation MattersMichael Levin-Epstein149October 9, 2026Monthlyhealthinnovationmatters.libsyn.com/websitehttps://healthinnovationmatters.libsyn.com/rsspodcastindex.org
The Psychology SistersThe Psychology Sisters149October 20, 2026Monthlythepsychcollaborative.com.auhttps://rss.buzzsprout.com/321149.rsspodcastindex.org
The Radiology Review PodcastMatt Covington149October 3, 2026Monthlytheradiologyreview.comhttps://feeds.captivate.fm/theradiologyreview/podcastindex.org
The ALL ME® PodcastTaylor Hooton Foundation149October 6, 2026Monthlyallme.libsyn.comhttps://rss.pdrl.fm/936bb2/feeds.libsyn.com/215387/rss/?redirect=falsepodcastindex.org
What Resonates?Andrea Kennedy149September 18, 2026Every two weekswhatresonatespodcast.comhttps://rss.buzzsprout.com/1454596.rsspodcastindex.org
Lewy Body Roller CoasterLinda and Curry149October 1, 2026Every two weekslewybodyrollercoasterpodcast.buzzsprout.comhttps://rss.buzzsprout.com/1298360.rsspodcastindex.org
Red Black and VeganMyCityMyMusic149October 25, 2026Monthlymycitymymusic.comhttps://www.spreaker.com/show/2070824/episodes/feedpodcastindex.org
Meditation Mama | Guided Meditations for Pregnancy, Labor & PostpartumKelly Smith149October 27, 2026Every two weeksart19.com/shows/meditation-mamahttps://rss.art19.com/meditation-mamapodcastindex.org
Today’s Autistic Moment: A Podcast for Autistic Adults by An Autistic AdultPhilip King-Lowe149October 24, 2026Every two weekstodaysautisticmoment.comhttps://anchor.fm/s/34bfee40/podcast/rsspodcastindex.org
Health Matters SACipla Africa149October 14, 2026Every two weeksmyhealthmatters.co.zahttps://anchor.fm/s/574bec5c/podcast/rsspodcastindex.org
Muscle, Performance & Science PodcastCircle Of Insight Productions149October 27, 2026Every two weeksspreaker.com/podcast/muscle-performance-science-podcast--5282026https://www.spreaker.com/show/5282026/episodes/feedpodcastindex.org
Around the Kinky Kampfire PodcastJulius Marques149October 29, 2026Every two weekskinkykampfirepodcast.buzzsprout.comhttps://rss.buzzsprout.com/1909679.rsspodcastindex.org
Midlife Women EntrepreneursLynette Turner149October 20, 2026Every two weeksprograms.lynetteturner.com/podcasts/midlife-women-entrepreneurshttps://rss.buzzsprout.com/2554683.rsspodcastindex.org
Inside BipolarHealthline Media149October 19, 2026Every two weekspsychcentral.com/ibphttps://feeds.megaphone.fm/RED6766707424podcastindex.org
Self RealizedLinton Bergsen149October 26, 2026Every two weeksselfrealized.comhttps://rss.buzzsprout.com/1402135.rsspodcastindex.org
Dose Of Vitamin J ShowDOVJS, LLC.149October 19, 2026Every two weeksdoseofvitaminjshow.comhttps://www.spreaker.com/show/5673825/episodes/feedpodcastindex.org
Get Savvy...Demystifying HealthcareSandy Kibling149October 29, 2026Every two weeksgetsavvydemystifyinghealthcare.buzzsprout.comhttps://rss.buzzsprout.com/2054498.rsspodcastindex.org
Apostolic PodcastApostle149October 25, 2026Every two weeksbuzzsprout.com/2068013https://rss.buzzsprout.com/2068013.rsspodcastindex.org
The Lifeline PodcastSimply BJE, Inc.149October 30, 2026Every two weekssimplybje.com/thelifelinehttps://rss.buzzsprout.com/2132402.rsspodcastindex.org
Build Your Reiki BusinessChristian Stone149October 19, 2026Every two weeksstandingstoneshealing.com/podcasthttps://anchor.fm/s/dcdda874/podcast/rsspodcastindex.org
The Eric Bach ShowEric Bach149October 27, 2026Every two weeksthe-eric-bach-show.captivate.fmhttps://feeds.captivate.fm/the-eric-bach-show/podcastindex.org
Funny Medicine PodcastJulia Brunet and Yvette Gonzalez, D.O.149October 27, 2026Every two weekslinktr.ee/funnymedicinehttps://media.rss.com/funnymedicinepodcast/feed.xmlpodcastindex.org
Reclaim Your Inner Balance with Lisa DornReclaim Your Inner Balance with Lisa Dorn149September 28, 2026Weeklylisadorn.podbean.comhttps://rss.buzzsprout.com/2258653.rsspodcastindex.org
Confidently Balance Your HormonesDee Davidson149October 26, 2026Weeklyconfidentlyloveyourself.squarespace.comhttps://feeds.transistor.fm/confidently-balance-your-hormonespodcastindex.org
Yoga Teacher Tips: Essential Conversations for Yoga TeachersMonica Bright, Yoga Teacher Trainer149October 26, 2026Weeklyenhanced-body.comhttps://rss.buzzsprout.com/2262195.rsspodcastindex.org
The Daring Well Podcast - Holistic Health & Wellness, Mindset, and Personal GrowthRita Mercer, Wellness, Mindset & Mental Health Expert149October 28, 2026Weeklydaringwell.comhttps://rss.buzzsprout.com/2270384.rsspodcastindex.org
Gyno Girl Presents: Sex, Drugs & HormonesDr. Sameena Rahman149October 30, 2026Weeklygyno-girl-presents-sdh.captivate.fmhttps://feeds.captivate.fm/gyno-girl-presents-sdh/podcastindex.org
Forgiveness Is For YOU - Overcome Trauma Through ForgivenessDr. Carron Silva: Forgiveness Guide, Christian Trauma Coach149October 27, 2026Weeklydrcarron.comhttps://feed.podbean.com/forgivenessisforyou/feed.xmlpodcastindex.org
Ageless Athlete — Healthy Aging for a Strong, Capable LifeKush Khandelwal149October 28, 2026Weeklyagelessathlete.cohttps://rss.buzzsprout.com/2300423.rsspodcastindex.org
The Pursuit of Progress PodcastAdam Lang and Benjamin Adams149October 30, 2026Weeklyadamsellsdenver.com/podcasthttps://api.riverside.fm/hosting/yeKeezhc.rsspodcastindex.org
Cardiology TrialsCardiology Trials149October 21, 2026Weeklycardiologytrials.substack.com/podcastpodcastindex.org
Migraine Freedom: Your wayDebbie Waidl149October 26, 2026Weeklysites.libsyn.com/498553https://feeds.libsyn.com/498553/rsspodcastindex.org
Continuum AudioAmerican Academy of Neurology149October 28, 2026Weeklycontinuumjournal.comhttps://feeds.libsyn.com/498048/rsspodcastindex.org
The Hint Hive: Amplifying Women's VoicesKelly Hint149October 30, 2026Weeklycoachkellyhint.comhttps://rss.buzzsprout.com/2317441.rsspodcastindex.org
MamaBeeVoice Natalia Poluektova-PisarevaNatalia Pisareva Poluektova149October 26, 2026Weeklypoluektova.mave.digitalhttps://cloud.mave.digital/62285podcastindex.org
That LEO GuyThat LEO Guy149October 30, 2026Several times a weekbuzzsprout.com/2508030https://rss.buzzsprout.com/2508030.rsspodcastindex.org
Appiah Counselling PodcastAppiah Counselling149October 2, 2026Several times a weekappiahcounselling.comhttps://anchor.fm/s/10d084464/podcast/rsspodcastindex.org
FIGHT LIKE HEALTHEm Wilson148September 29, 2026Monthlyfightlikehealth.libsyn.com/websitehttps://emileewilson.libsyn.com/rsspodcastindex.org
UF Health MedEd CastUF Health Shands Hospital148October 29, 2026Monthlyinnovation.ufhealth.org/podcastshttps://support.doctorpodcasting.com/podcastfeed/242podcastindex.org
Strength In KnowledgeR2P Academy148October 26, 2026Every two weeksspreaker.com/show/strength-in-knowledgehttps://www.spreaker.com/show/4492630/episodes/feedpodcastindex.org
The Game Speed PodcastGame Speed Podcast148October 30, 2026Every two weeksspeedandpowerpodcast.libsyn.com/websitehttps://speedandpowerpodcast.libsyn.com/rsspodcastindex.org
Easy Stress CuresStephen Carter148October 13, 2026Monthlysites.google.com/view/mind-over-stress/homehttps://www.spreaker.com/show/4154713/episodes/feedpodcastindex.org
Corrective CultureCallan Krause148October 22, 2026Every two weekscorrective-culture.simplecast.comhttps://feeds.simplecast.com/6FyKcvMUpodcastindex.org
Schizophrenia: Three Moms in the TrenchesRandye Kaye148October 15, 2026Every two weeksrandyekaye.com/schizophrenia-three-moms-in-the-trencheshttps://rss.buzzsprout.com/1604296.rsspodcastindex.org
The Pod ProjectChloe Longstaff148October 12, 2026Every two weeksbuzzsprout.com/1872910https://rss.buzzsprout.com/1872910.rsspodcastindex.org
Monday Motivational Minute: Boost Your Mood with Lucy SaltmarshLucy Saltmarsh148October 26, 2026Every two weekslucysaltmarsh.podbean.comhttps://feed.podbean.com/lucysaltmarsh/feed.xmlpodcastindex.org
Dose of DepthDeborah Lukovich, PhD148October 8, 2026Every two weeksdoseofdepth.buzzsprout.comhttps://rss.buzzsprout.com/1917216.rsspodcastindex.org
Parkinson's Disease Education PodcastDr. Michael Hyland, DPT, CEEAA148October 21, 2026Every two weekssites.libsyn.com/397757https://feeds.libsyn.com/397757/rsspodcastindex.org
Caroline Carey: A Neurodivergent SoulCaroline Carey148October 29, 2026Every two weeksmiddleearthmedicine.compodcastindex.org
Breaking Waves89.7 Eastside FM148October 26, 2026Every two weekswp.eastsidefm.org/series/breaking-waveshttps://wp.eastsidefm.org/feed/podcast/breaking-waves/podcastindex.org
Unlock Your Vitality with MagalionajourneyMagali Mathieu148October 21, 2026Every two weeksmagalionajourney.com/podcasts/unlock-your-vitality-with-magalionajourneyhttps://app.kajabi.com/podcasts/2147509371/feedpodcastindex.org
The Movement Church CORichie Fike148October 26, 2026Weeklyspreaker.com/podcast/the-movement-church-co--5973614https://www.spreaker.com/show/5973614/episodes/feedpodcastindex.org
The Big Drink RethinkAnna Donaghey148October 29, 2026Weeklythebigdrinkrethink.com/podcasthttps://feeds.captivate.fm/the-big-drink-rethink/podcastindex.org
AcuPro - The Wonders of Acupuncture & Chinese MedicineClara Cohen148October 28, 2026Weeklyacuproacademy.comhttps://rss.buzzsprout.com/2276216.rsspodcastindex.org
The Feed My Health PodcastRosalind Tapper148October 16, 2026Weeklyinstagram.com/rosalind.feedmyhealthhttps://rss.buzzsprout.com/2302442.rsspodcastindex.org
Restorative AudioVibes AI148August 7, 2026Weeklyvibesbiowear.ai/product/restorativeaudiohttps://rss.buzzsprout.com/2200587.rsspodcastindex.org
Master Your Yoga Teaching with MaKenzie FlyMaKenzie Fly148October 21, 2026Weeklymasteryouryogateaching.comhttps://api.riverside.com/hosting/TzEks9JE.rsspodcastindex.org
The Inspired YogiJim (The Yogi)148October 17, 2026Weeklyfacebook.com/profile.phphttps://rss.buzzsprout.com/2367132.rsspodcastindex.org
No BS FitnessNo BS Fitness148October 25, 2026Weeklysites.libsyn.com/506023https://feeds.libsyn.com/506023/rsspodcastindex.org
Calling In SickJust Media148October 28, 2026Weeklyhttps://feeds.megaphone.fm/JMC8730830780podcastindex.org
Begin Again with Davina McCallFlightStory148October 29, 2026Weeklyhttps://feeds.megaphone.fm/beginagainpodcastindex.org
The Dementia DialoguesNatalie Carter148October 28, 2026Weeklysites.libsyn.com/554062https://feeds.libsyn.com/554062/rsspodcastindex.org
The Erotic RealmEmma | Psychology of Desire148October 30, 2026Weeklyart19.com/shows/the-erotic-realmhttps://rss.art19.com/the-erotic-realmpodcastindex.org
The On the Go PodcastTyler Whiting148October 27, 2026Weeklybuzzsprout.com/2438517https://rss.buzzsprout.com/2438517.rsspodcastindex.org
Unfiltered & Unapologetic with CaitlinCaitlin148October 27, 2026Several times a weekunfilteredandunapologetic.buzzsprout.comhttps://rss.buzzsprout.com/2500478.rsspodcastindex.org
The Faith Beyond Trauma PodcastPastor Reggie148October 16, 2026Several times a weekthefaithbeyondtraumapodcast.buzzsprout.comhttps://rss.buzzsprout.com/2522657.rsspodcastindex.org
Hope Survives | Brain Injury PodcastCristabelle Braden and Hope Survives148October 28, 2026Every two weekshopesurvives.orghttps://feeds.captivate.fm/hopesurvives/podcastindex.org
The Melanin Wellness Podcast: Mental Health, Nervous System Care & Healing for Black WomenCori Dunn148October 28, 2026Every two weeksthemelaninwellnesspodcast.podbean.comhttps://feed.podbean.com/themelaninwellnesspodcast/feed.xmlpodcastindex.org
Heart 2 Talk with Theresa CesareTheresa Cesare147October 31, 2026Every two weeksheart2talkwiththeresacesare.buzzsprout.comhttps://rss.buzzsprout.com/1058887.rsspodcastindex.org
The Convenient CounselorBriana Leach, LPC147October 21, 2026Monthlyconvenientcounselor.comhttps://rss.buzzsprout.com/275153.rsspodcastindex.org
Philosophy of StrengthCillian O’Connor147October 27, 2026Monthlypodcasters.spotify.com/pod/show/cill-o-connorhttps://anchor.fm/s/bc595bc/podcast/rsspodcastindex.org
340B InsightVoxtopica147October 19, 2026Monthly340bpodcast.comhttps://feeds.transistor.fm/340b-health-insightspodcastindex.org
How Can I Help? - with Dr. Gail SaltzSpokenLayer147October 29, 2026Every two weekshttps://feeds.megaphone.fm/how-can-i-helppodcastindex.org
Where Work Meets Life™ with Dr. LauraDr. Laura147October 20, 2026Every two weeksdrlaura.livehttps://feeds.simplecast.com/kgdtlLHBpodcastindex.org
Your Ultimate ComebackBrad Davidson & Raquel Perry147October 27, 2026Weeklybuzzsprout.com/1449706https://rss.buzzsprout.com/1449706.rsspodcastindex.org
Girl Out of Order PodcastChristine Gale147October 27, 2026Every two weeksgirloutoforder.comhttps://rss.buzzsprout.com/1411279.rsspodcastindex.org
The Balut Kiki ProjectThe Balut Kiki Project147October 21, 2026Every two weeksbalutkiki.comhttps://rss.buzzsprout.com/1765597.rsspodcastindex.org
Family in Focus®Wendy Schofer, MD147September 2, 2026Every two weekswendyschofermd.comhttps://api.riverside.fm/hosting/T0kmzTlh.rsspodcastindex.org
It's Where I Am with Zandra PolardZandra Polard147August 9, 2026Every two weeksitswhereiam.comhttps://feeds.transistor.fm/its-where-i-am-with-zandra-polardpodcastindex.org
Toni UnleashedToni Shelaske147October 14, 2026Every two weekssites.libsyn.com/408143https://feeds.libsyn.com/408143/rsspodcastindex.org
The Self-Love Recovery PodcastRoss Rosenberg, M. Ed.147October 29, 2026Every two weeksselfloverecovery.com/pages/self-love-recovery-podcasthttps://rss.buzzsprout.com/2071025.rsspodcastindex.org
Sensible MedicineSensible Medicine Authors and Editors147October 21, 2026Every two weekssensible-med.com/podcastpodcastindex.org
School of Rock BottomOliver Mason147October 27, 2026Every two weekslinktr.ee/olivermasonhttps://anchor.fm/s/d95d1e64/podcast/rsspodcastindex.org
The Bhandwagon PodcastRicky Bhandal147October 16, 2026Every two weeksredcircle.com/shows/bhandwagonhttps://feeds.redcircle.com/d8ddf259-aea9-40a6-bf49-26ab0c7a8177podcastindex.org
Elle SeraElle Sera147October 15, 2026Every two weeksbuzzsprout.com/2176309https://rss.buzzsprout.com/2176309.rsspodcastindex.org
Commando Conditioned Fitness - The EverWild PodcastLuke Fletcher147October 21, 2026Every two weekspodcasters.spotify.com/pod/show/luke4462https://anchor.fm/s/e2ca6664/podcast/rsspodcastindex.org
Tell Me How You're Mighty: Real Talk About CheatingTracy Schorn147October 27, 2026Every two weekstellmehowyouremighty.comhttps://feeds.libsyn.com/477381/rsspodcastindex.org
How do you feel today?See how you feel at moodapp.io147October 28, 2026Every two weeksmoodapp.iohttps://anchor.fm/s/dbdf8640/podcast/rsspodcastindex.org
WanzologyMichael Wansley147October 28, 2026Weeklyhttps://feeds.transistor.fm/wanzologypodcastindex.org
Debi Changes LivesTalk 4 Podcasting147October 22, 2026Weeklyspreaker.com/podcast/debi-changes-lives--5979847https://www.spreaker.com/show/5979847/episodes/feedpodcastindex.org
Sober & Lit PodcastRuby Williams147October 27, 2026Weeklyfreedomrenegadecoaching.comhttps://rss.buzzsprout.com/2287460.rsspodcastindex.org
SHOCK & Y’ALLNicole Sciacca147October 27, 2026Weeklyshock-yall.captivate.fmhttps://feeds.captivate.fm/shock-yall/podcastindex.org
mind youCharlotte Cummings147October 25, 2026Weeklyfeelbetterwithcharlotte.podbean.comhttps://anchor.fm/s/fefdafe4/podcast/rsspodcastindex.org
Wellness UncensoredTalk 4 Podcasting147October 29, 2026Weeklyspreaker.com/podcast/wellness-uncensored--5937142https://www.spreaker.com/show/5937142/episodes/feedpodcastindex.org
The Many Faces of CancerMelissa Grosboll147October 27, 2026Weeklybuzzsprout.com/2322714https://rss.buzzsprout.com/2322714.rsspodcastindex.org
Heal with GraceGrace Secker147October 27, 2026Weeklyelevatetherapywellness.comhttps://rss.buzzsprout.com/2346801.rsspodcastindex.org
Compassion in a T-ShirtDr Stan Steindl147October 30, 2026Weeklycompassion-in-a-t-shirt.captivate.fmhttps://feeds.captivate.fm/compassion-in-a-t-shirt/podcastindex.org
Laura K CoachingLaura King147October 27, 2026Every two weekspodcasters.spotify.com/pod/show/coachedbylkhttps://anchor.fm/s/caff29c0/podcast/rsspodcastindex.org
Your Mindset MattersVikki Cronin147October 30, 2026Less than monthlythemacrocoach.iehttps://anchor.fm/s/edd44bb0/podcast/rsspodcastindex.org
SOUL FUELED ✨️ AFAubrey Conley147October 28, 2026Several times a weekmommaaf.podbean.comhttps://feed.podbean.com/MommaAF/feed.xmlpodcastindex.org
Era Beauty & Wellness PodcastClinical Strength Clean Beauty & Wellness147August 13, 2026Several times a weekerabeautywellness.substack.com/podcastpodcastindex.org
The Lifestyles of the Determined Podcast | Faith, Clarity, and Sustainable GrowthLifestyles of the Determined Podcast with Erica147October 20, 2026Several times a weeklifestylesofthedetermined.podbean.comhttps://feed.podbean.com/Lifestylesofthedetermined/feed.xmlpodcastindex.org
UTHSC PA Program PodcastUTHSC PA Program147October 30, 2026Several times a weeksites.libsyn.com/591500https://feeds.libsyn.com/591500/rsspodcastindex.org
A New Day with Gerry Hussey147October 30, 2026Dailypscrb.fm/rss/p/goloudplayer.com/podcasts/a-new-day-with-gerry-hussey-1180https://rss.podplaystudio.com/3842.xmlpodcastindex.org
Healthcare Executive PodcastAmerican College of Healthcare Executives146October 28, 2026Monthlyhealthcareexecutive.org/podcasthttps://support.doctorpodcasting.com/podcastfeed/350podcastindex.org
Spaceman’s TransmissionsTonepoet146October 11, 2026Monthlytonepoet.podbean.comhttps://tonepoet.podbean.com/feed.xmlpodcastindex.org
Honestly UnbalancedAdam Husler146October 14, 2026Monthlyhonestlyunbalanced.comhttps://feeds.captivate.fm/honestly-unbalanced/podcastindex.org
Mindflow Radio: The Path is the DestinationJai and Monte146October 4, 2026Monthlymindflowradio.lifehttps://rss.buzzsprout.com/289594.rsspodcastindex.org
Beyond the Prophy®Beyond the Prophy LLC146October 26, 2026Monthlyjasminhaley.com/podcasts/beyond-the-prophyhttps://app.kajabi.com/podcasts/2147493772/feedpodcastindex.org
American Ambulance EMS PodcastAmerican Ambulance146October 7, 2026Monthlyamericanambulance.comhttps://rss.buzzsprout.com/956239.rsspodcastindex.org
The Dental Marketing Secrets PodcastMark Thackeray146October 30, 2026Monthlymarkthackeray.comhttps://rss.buzzsprout.com/629479.rsspodcastindex.org
Her Best VersionNaturopath Kasey Willson146October 20, 2026Every two weekskaswywillson.comhttps://rss.libsyn.com/shows/298241/destinations/2356895.xmlpodcastindex.org
Sober Talk SAChris W146October 29, 2026Every two weekspodcasters.spotify.com/pod/show/sober-talk-sahttps://anchor.fm/s/4a52d7e0/podcast/rsspodcastindex.org
Strong EnoughClaudia King146October 1, 2026Every two weeksstrong-enough.simplecast.comhttps://feeds.simplecast.com/KoWy_I2Ppodcastindex.org
Love At First ScienceAlba Yoga Academy146October 30, 2026Every two weeksalbayogaacademy.comhttps://anchor.fm/s/62329fe4/podcast/rsspodcastindex.org
The Brain People PodcastChristian Freed146October 19, 2026Every two weeksthebrainpeoplepodcast.comhttps://feeds.transistor.fm/the-brain-people-podcastpodcastindex.org
Simple Steps to Better Health with Adiel GorelAdiel Gorel146October 18, 2026Every two weeksadielgorel.comhttps://adielgorel.libsyn.com/rsspodcastindex.org
You Stop You with Scott RasmussenScott Rasmussen146October 17, 2026Every two weeksyoustopyou.comhttps://rss.buzzsprout.com/1904354.rsspodcastindex.org
Move With HeartMelissa Wood-Tepperberg146August 19, 2026Every two weeksmelissawoodhealth.compodcastindex.org
Unf*ck YourselfAllie146October 27, 2026Every two weeksbuzzsprout.com/2054335https://rss.buzzsprout.com/2054335.rsspodcastindex.org
Beyond the StatisticsIngrid Dutton146October 21, 2026Every two weeks1in3podcast.comhttps://rss.buzzsprout.com/2121733.rsspodcastindex.org
BackTable Bone & SportsBackTable Inc.146October 27, 2026Every two weeksbacktable.com/shows/mskhttps://feeds.megaphone.fm/BTL8250211472podcastindex.org
Calgary Mindfulness Weekly MeditationCalgary Mindfulness146October 26, 2026Every two weeksrss.com/podcasts/calgary-mindfulnesshttps://media.rss.com/calgary-mindfulness/feed.xmlpodcastindex.org
Made It OutMade It Out Media146September 1, 2026Weeklymadeitoutmedia.compodcastindex.org
Lights Out Library: Sleep DocumentariesOlimpia Pérez146October 25, 2026Weeklypodcasters.spotify.com/pod/show/lights-out-library7https://feeds.megaphone.fm/GSGP3700210220podcastindex.org
The Ordinary Doula PodcastAngie Rosier146October 30, 2026Weeklybirthlearning.comhttps://rss.buzzsprout.com/2267018.rsspodcastindex.org
The Supra Human ShowSupra Human146October 30, 2026Weeklysites.libsyn.com/500243https://anchor.fm/s/ffbcb8f8/podcast/rsspodcastindex.org
Pieces To WellnessTPP146October 28, 2026Weeklybuzzsprout.com/2296811https://rss.buzzsprout.com/2296811.rsspodcastindex.org
Lose Weight Mindfully | weight loss, mindful eating, healthy recipes, emotional eating, boost energyJackie Kirschen, Registered Dietitian, Weight Loss Nutritionist & Mindful Eating Coach146October 26, 2026Weeklyeatright4life.comhttps://anchor.fm/s/eaa0b410/podcast/rsspodcastindex.org
MeSsy with Christina Applegate & Jamie Lynn SiglerWishbone Production146October 27, 2026Weeklymessy-with-christina-applegate-jamie-lynn-sigler.simplecast.comhttps://feeds.simplecast.com/ibNfebJVpodcastindex.org
From the Spectrum: Finding Superpowers with AutismRyan Sumner146October 30, 2026Weeklyrss.com/podcasts/fromthespectrumhttps://media.rss.com/fromthespectrum/feed.xmlpodcastindex.org
Before You BloomHayley Kinneavy146October 24, 2026Every two weekspodcasters.spotify.com/pod/show/before-you-bloomhttps://anchor.fm/s/dcde8d5c/podcast/rsspodcastindex.org
MedicsVoicesDomhnall MacAuley146September 24, 2026Weeklymedicsvoices.comhttps://anchor.fm/s/fc332f64/podcast/rsspodcastindex.org
Roots of the Rise | Authentic Alignment and TransformationSarah Hope | Whole Person Healing, Soul Deep Transformation146September 23, 2026Weeklyrootsoftherise.comhttps://rss.buzzsprout.com/2451696.rsspodcastindex.org
The Alcohol Reset by Cloud9Cloud9 Health146October 28, 2026Weeklytrycloud9.comhttps://feeds.transistor.fm/the-alcohol-resetpodcastindex.org
Anxious Christian Teen | Anxiety Symptoms, Insecurity, Overwhelmed, Stressed, Self-Esteem, Social Anxiety, Peace in the BibleKristen Phillips, M.S.Ed. | Teen Anxiety Coach146October 30, 2026Several times a weekkristenbphillips.podbean.comhttps://feed.podbean.com/kristenbphillips/feed.xmlpodcastindex.org
Made It OutMade It Out Media146September 1, 2026Weeklymadeitoutmedia.comhttps://feeds.megaphone.fm/madeitoutpodcastpodcastindex.org
Smart Sex, Smart Love with Dr Joe KortDr Joe Kort145September 15, 2026Monthlyjoekort.com/podcasthttps://rss.buzzsprout.com/1750559.rsspodcastindex.org
The NACE Clinical Highlights ShowNACE145October 1, 2026Every two weeksnaceonline.comhttps://rss.buzzsprout.com/457981.rsspodcastindex.org
The Academic ImperfectionistRebecca Roache145October 30, 2026Every two weeksacademicimperfectionist.comhttps://rss.buzzsprout.com/1420324.rsspodcastindex.org
ELEVATE PodcastElevation Barn145October 13, 2026Every two weekselevationbarn.comhttps://rss.buzzsprout.com/1373803.rsspodcastindex.org
IntrospectionKris145October 30, 2026Every two weekshttps://anchor.fm/s/35126918/podcast/rsspodcastindex.org
The Technician PodcastTravis Cochran145October 27, 2026Every two weeksbuzzsprout.com/1815205https://rss.buzzsprout.com/1815205.rsspodcastindex.org
The Raise Podcast with Carol BarwickCarol Barwick145October 31, 2026Every two weeksraise4all.comhttps://anchor.fm/s/521adc20/podcast/rsspodcastindex.org
ADHD Aha!Understood.org145October 27, 2026Every two weeksunderstood.org/en/podcasts/adhd-ahahttps://feeds.simplecast.com/yjHKUkkHpodcastindex.org
5-Minute Clinical Update and Grand Rounds with Dr. Thomas McGinnCommonSpirit Health Physician Enterprise145October 28, 2026Every two weeksbuzzsprout.com/1903646https://rss.buzzsprout.com/1903646.rsspodcastindex.org
Daze of Our LivesNZME145October 26, 2026Every two weeksthehits.co.nzhttps://www.omnycontent.com/d/playlist/7784f840-c291-422a-924b-ad9000bbad71/6a667346-e8fd-4b27-963f-b1af017a2ca6/39ce3f82-6f20-4ea1-8e2e-b1af017a46aa/podcast.rsspodcastindex.org
The CatalystChris Cooper145October 17, 2026Every two weekscatalystgym.comhttps://feeds.captivate.fm/thecatalystmethod/podcastindex.org
The Just A Mom PodcastSusie Gurley145October 27, 2026Every two weeksthejustamompodcast.comhttps://feeds.transistor.fm/the-just-a-mom-podcastpodcastindex.org
Forum Health Integrative Medicine PodcastForum Health145October 27, 2026Every two weeksforumhealth.comhttps://anchor.fm/s/10b000c9c/podcast/rsspodcastindex.org
Healing The Source PodcastClaudia Briare145October 28, 2026Every two weekshealingthesource.cohttps://feeds.libsyn.com/451539/rsspodcastindex.org
feelgooderyKyle Buchanan145October 22, 2026Every two weeksbuzzsprout.com/2142610https://rss.buzzsprout.com/2142610.rsspodcastindex.org
THE DCA PodcastDidi Ferrari145October 26, 2026Every two weekscoachedbydidi.co.uk/podcasts/the-dca-podcasthttps://app.kajabi.com/podcasts/2147496425/feedpodcastindex.org
Dr Julie's Coffee ChatsDr Julie145October 27, 2026Every two weeksdrjulie.co.nzhttps://rss.buzzsprout.com/2209347.rsspodcastindex.org
GNAC InsiderGNAC145October 30, 2026Monthlyblogtalkradio.com/gnacinsiderhttps://rss.buzzsprout.com/2230722.rsspodcastindex.org
This Is Grief Too with Laverne McKinnonLaverne McKinnon145October 26, 2026Every two weeksthisisgrieftoo.substack.com/podcastpodcastindex.org
Hack Your HappinessSmall Bits of Happiness145September 16, 2026Weeklysmallbitsofhappiness.comhttps://anchor.fm/s/e539c4d0/podcast/rsspodcastindex.org
THE DIMPLE BINDRA SHOWDimple Bindra145October 19, 2026Weeklybuzzsprout.com/2305884https://rss.buzzsprout.com/2305884.rsspodcastindex.org
Running PartnersPaul Griffiths and Alison Scope145October 18, 2026Weeklyrunning-partners.captivate.fmhttps://feeds.megaphone.fm/COMG2714123991/podcastindex.org
The Driven AthleteDr. Kyle Volstad, PT, DPT, OCS, FAAOMPT, CSCS145October 29, 2026Weeklyathleterestorationcompany.comhttps://rss.buzzsprout.com/2253031.rsspodcastindex.org
Reflective Hour with Tammy Toney-ButlerTammy Toney-Butler145October 27, 2026Weeklyreflectivespacesministry.comhttps://rss.buzzsprout.com/2255846.rsspodcastindex.org
Truth in CoachingJoshua Spencer145October 2, 2026Weeklyshows.acast.com/truth-in-coachingpodcastindex.org
Gettin Real with Cockney BuddhaCockney Buddha145October 30, 2026Weeklymindnutrition4all.comhttps://rss.buzzsprout.com/2286205.rsspodcastindex.org
Beyond DiagnosisRita De Michele145October 15, 2026Weeklybeyonddiagnosis.buzzsprout.comhttps://rss.buzzsprout.com/1792698.rsspodcastindex.org
Far 2 FabulousJulie Clark & Catherine Chapman145October 29, 2026Weeklyfar2fabulous.buzzsprout.comhttps://rss.buzzsprout.com/2278731.rsspodcastindex.org
Five Year YouAndrew Dewar and Catherine Collins145October 28, 2026Weeklyfiveyearyou.com/podcasthttps://feeds.captivate.fm/five-year-you/podcastindex.org
Pleasure Uprising: Desire, Attachment, and the Sex You Actually WantLaura Jurgens, Ph.D.145October 26, 2026Weeklylaurajurgens.com/podcasthttps://rss.buzzsprout.com/2303792.rsspodcastindex.org
Lead Well! with Christine SchickingerChristine Schickinger145October 20, 2026Weeklychristine-schickinger.comhttps://lead-well-podcast.podigee.io/feed/mp3podcastindex.org
Everyday Epigenetics: Raw. Real. Relatable.Susan Robbins145October 19, 2026Weeklyeverydayepigenetics.buzzsprout.comhttps://rss.buzzsprout.com/2328546.rsspodcastindex.org
the strong women collective podcastHarriet Buttigieg145October 22, 2026Weeklypodcasters.spotify.com/pod/show/harriet-buttigieghttps://anchor.fm/s/f3de03fc/podcast/rsspodcastindex.org
StRest with Kerstin LindquistKerstin Lindquist145October 27, 2026Weeklykerstin-lindquist.comhttps://feeds.megaphone.fm/TGL6397982646podcastindex.org
Blue Chip Athletic Club by Blaise CurtisBlaise Curtis145October 23, 2026Weeklybluechipathleticclub.comhttps://api.riverside.fm/hosting/nrPWTa5B.rsspodcastindex.org
Spiritual Sanctuary: Wisdom for the Divine FeminineBertena, Priestess145October 27, 2026Every two weeksbertena.orghttps://feeds.captivate.fm/spiritual-sanctuary/podcastindex.org
OptiCast - The Optimization Lab PodcastThe Optimization Lab145October 30, 2026Dailybuzzsprout.com/2610091https://rss.buzzsprout.com/2610091.rsspodcastindex.org
Demystifying Gay PornI. Que Grande144September 17, 2026Monthlydemystifyinggayporn.buzzsprout.comhttps://rss.buzzsprout.com/450796.rsspodcastindex.org
JAMA Psychiatry Author InterviewsAmerican Medical Association144October 14, 2026Monthlyjamanetwork.com/journals/jamapsychiatryhttps://jamapsychiatryauthorinterviews.libsyn.com/rsspodcastindex.org
Unstoppable With Shangrila RendonShangrila Rendon144October 29, 2026Monthlyfeistyfoxfire.podbean.comhttps://feed.podbean.com/feistyfoxfire/feed.xmlpodcastindex.org
Coffee with The Couple CureJay & Lori Pyatt144October 22, 2026Monthlythecouplecure.com/blog-podcasthttps://thecouplecure.com/feed/podcast/podcastindex.org
D&M's with DEANDean Lucas144September 13, 2026Monthlyan-off-track-experience.zencast.websitepodcastindex.org
Living At Your FinestDR.BABS144September 30, 2026Every two weekslivingatyourfinest.comhttps://rss.buzzsprout.com/1202669.rsspodcastindex.org
Dreams Around The WorldDan144September 25, 2026Every two weeksdreamsaroundtheworld.comhttps://www.spreaker.com/show/2218653/episodes/feedpodcastindex.org
Nurturing Words: Voices of ExperienceMotherless Daughters Ministry144October 9, 2026Every two weeksmotherlessdaughtersministry.comhttps://rss.buzzsprout.com/1040194.rsspodcastindex.org
Owning Pleasure As A Black WomanNatasha Riley144October 30, 2026Every two weeksjaverywellness.comhttps://feeds.captivate.fm/owning-pleasure-as-a-bl/podcastindex.org
Living While Loving Your Child Through AddictionHeather Ross144October 14, 2026Every two weeksheatherrosscoaching.comhttps://anchor.fm/s/3ea864a0/podcast/rsspodcastindex.org
Elevate with EricaErica Renee144October 12, 2026Every two weeksinstagram.com/ms_erica_reneehttps://rss.buzzsprout.com/1705909.rsspodcastindex.org
Kingdom Mothers Rise UpMukkove - The Mom Mentor144September 22, 2026Every two weeksmukkovejohnson.comhttps://rss.buzzsprout.com/1999324.rsspodcastindex.org
The Dark StudioBrandon Richey144October 27, 2026Every two weeksbrandonrichey.substack.com/podcastpodcastindex.org
Focus and Chill - productivity tactics for AuDHDers and other neurodivergent folksFocus Bear Pty Ltd144October 11, 2026Every two weekspodcast.focusbear.iohttps://feeds.transistor.fm/focus-and-chillpodcastindex.org
Eat Like RubyRuby Fraser144October 26, 2026Several times a weekbuzzsprout.com/2311219https://rss.buzzsprout.com/2311219.rsspodcastindex.org
Inside Athletic TrainingThe Professional Baseball Athletic Trainers Society144October 30, 2026Every two weekspbats.comhttps://rss.buzzsprout.com/2112084.rsspodcastindex.org
The Shameless RomanticKat Wilhoit144October 21, 2026Every two weekstheshamelessromantic.buzzsprout.comhttps://rss.buzzsprout.com/2064287.rsspodcastindex.org
Beyond the PillsJosh Rimany144October 27, 2026Every two weeksbeyond-the-pills.captivate.fmhttps://feeds.captivate.fm/beyond-the-pills/podcastindex.org
Learn to Thrive with ADHD PodcastMande John144October 29, 2026Every two weekslearntothrivewithadhd.comhttps://rss.buzzsprout.com/1954263.rsspodcastindex.org
Making It AwkwardJessica Wilson, MS RD144October 22, 2026Every two weekspatreon.com/MakingItAwkwardhttps://rss.libsyn.com/shows/600200/destinations/5222235.xmlpodcastindex.org
Rising From ShameMind Body Spirit.fm144October 2, 2026Weeklymindbodyspirit.fm/shows/rising-from-shamehttps://feeds.megaphone.fm/nadiadavishomeiswithinyoupodcastindex.org
Soul AwakeningJoy Truscott144August 13, 2026Weeklyjoytruscott.comhttps://rss.buzzsprout.com/2252456.rsspodcastindex.org
Live Parkinson's - Live an Exceptional Life!Chris144September 25, 2026Weeklybuzzsprout.com/2255986https://rss.buzzsprout.com/2255986.rsspodcastindex.org
Radical Remission Project ”Stories That Heal” PodcastRadical Remission Project144October 28, 2026Weeklyradicalremissionpodcast.podbean.comhttps://feed.podbean.com/radicalremissionpodcast/feed.xmlpodcastindex.org
Mums F**king MatterLucy Wylde144October 27, 2026Weeklymums-fking-matter.captivate.fmhttps://feeds.captivate.fm/mums-fking-matter/podcastindex.org
Fertility, Pregnancy, & Period Tips: Hormone Health ClassVanda, Fertility & Hormone Nurse + Functional Practitioner144October 27, 2026Weeklyhormonehealthclass.buzzsprout.comhttps://rss.buzzsprout.com/2214197.rsspodcastindex.org
Living ClarityKadampa Buddhism144October 26, 2026Weeklykadampa.orghttps://feeds.castos.com/v4d15podcastindex.org
Care Talk with Laura Packard: American Health Care ExplainedLaura Packard144September 22, 2026Every two weeksredcircle.com/shows/care-talk-with-laura-packardhttps://feeds.redcircle.com/f4520de0-f5b9-4ba9-b510-a517553cf327podcastindex.org
Speak Honest Podcast: Real Talk on Relationships, Attachment Styles & the Work of Healing Childhood TraumaJennifer Noble, PCC | Relationship Coach, TEDx Speaker, & Best Selling Author144October 28, 2026Weeklyspeak-honest.comhttps://rss.buzzsprout.com/2253591.rsspodcastindex.org
Next Level Play Therapy: A Podcast for Play Therapy ExcellenceCathi Spooner, LCSW, RPT-S144October 29, 2026Weeklyrhplaytherapytraining.comhttps://rss.buzzsprout.com/2021678.rsspodcastindex.org
A Cup of Dri: Fitness Thoughts from My Car to YoursAdriana Mastronardi144October 28, 2026Weeklypodcasters.spotify.com/pod/show/acupofdrihttps://api.riverside.com/hosting/ZPZqJ7EK.rsspodcastindex.org
CannaFitness and Nutrition PodcastBeth Skinner Jasinski144October 28, 2026Weeklycannafitnessnutrition.comhttps://anchor.fm/s/ec0b1dcc/podcast/rsspodcastindex.org
Pour Out Your JoyBethany and Carol144October 27, 2026Weeklypouroutyourjoy.buzzsprout.comhttps://rss.buzzsprout.com/2252348.rsspodcastindex.org
The Valiant ForgeMark Osborne144October 31, 2026Weeklythevaliantforge.comhttps://feeds.captivate.fm/the-valiant-forge/podcastindex.org
Endoscopy EssentialsThomas Rösch144October 30, 2026Weeklyendoscopy-essentials.comhttps://anchor.fm/s/f79c9b34/podcast/rsspodcastindex.org
The Functional Code PodcastDr. Jace Nybo, Dr. Addy Knutson144October 28, 2026Weeklypodcasters.spotify.com/pod/show/the-functional-code-podcahttps://anchor.fm/s/f147e02c/podcast/rsspodcastindex.org
Mind Set in Stone PodcastBig L Riz144October 26, 2026Weeklybiglrizmedia.comhttps://rss.buzzsprout.com/2419636.rsspodcastindex.org
The Intimacy InquiryAndrew Phipps144October 21, 2026Weeklyrss.com/podcasts/the-intimacy-inquiryhttps://media.rss.com/the-intimacy-inquiry/feed.xmlpodcastindex.org
PCOS Unfiltered: Nourish, Heal, ThriveLindsie Vizethann144October 30, 2026Weeklypcos-unfiltered-nourish-heal-thrive.simplecast.comhttps://feeds.simplecast.com/PvQuCz0wpodcastindex.org
The Other Side of AddictionAl Richards144October 20, 2026Several times a weekredcircle.com/shows/the-other-side-of-addictionhttps://feeds.redcircle.com/e4372363-4211-467d-8e1c-35f0330f6168podcastindex.org
WhispersoftBret Wellman144October 29, 2026Several times a weekpodcasters.spotify.com/pod/show/bret-wellmanhttps://anchor.fm/s/10e010e3c/podcast/rsspodcastindex.org
Dr Sam RobbinsDr Sam Robbins144October 31, 2026All episodes at oncehttps://feeds.megaphone.fm/dr-sam-robbinspodcastindex.org
The Dietitian CafeNualtra143October 28, 2026Monthlynualtra.comhttps://rss.buzzsprout.com/2414030.rsspodcastindex.org
Healing At The Edge with RamDev Dale BorglumBe Here Now Network143October 21, 2026Monthlyart19.com/shows/dale-borglum-with-healing-at-the-edgehttps://rss.art19.com/dale-borglum-with-healing-at-the-edgepodcastindex.org
The NeuFit Undercurrent PodcastGarrett Salpeter143October 23, 2026Monthlyneu.fit/podcasthttps://undercurrent.libsyn.com/rsspodcastindex.org
Mindset Is ArtCJ Ledy143October 26, 2026Every two weekscjledy.comhttps://rss.buzzsprout.com/1772182.rsspodcastindex.org
The ADHD Clarity Coach: ADHD Crash CourseDonae Cannon143October 21, 2026Every two weekstheadhdclaritycoach.comhttps://rss.buzzsprout.com/1833238.rsspodcastindex.org
Right Your Own StoryJames Taylor143October 10, 2026Every two weeksrightyourownstory.co.ukhttps://anchor.fm/s/6c502578/podcast/rsspodcastindex.org
The 5:32am Podcast.Ryan Stirton143October 26, 2026Every two weeksinstagram.com/ryan_stirtonpthttps://feeds.transistor.fm/the-rls-podcastpodcastindex.org
She ShieldSofia Espina143September 21, 2026Every two weekssheshieldpodcast.buzzsprout.comhttps://rss.buzzsprout.com/1895818.rsspodcastindex.org
Goaliath: Achieve your ultimate goals with meSean Lynch143October 10, 2026Every two weeksbuzzsprout.com/1921878https://rss.buzzsprout.com/1921878.rsspodcastindex.org
The Tequila HourAmanda Jeffrey143October 18, 2026Every two weeksthetequilahour.buzzsprout.comhttps://rss.buzzsprout.com/1928778.rsspodcastindex.org
Man UpDr. Kevin Chu and Dr. Justin Dubin143October 26, 2026Every two weeksthemanuppod.comhttps://anchor.fm/s/6707a8c0/podcast/rsspodcastindex.org
Becca BabblesBecca143October 19, 2026Every two weeksredcircle.com/shows/becca-babbles-podcasthttps://feeds.redcircle.com/81463372-aed6-46df-b3a6-ea1d810a35ffpodcastindex.org
Balance and BarbellsKayla Durck143October 9, 2026Every two weekskayladurck.comhttps://rss.buzzsprout.com/2054882.rsspodcastindex.org
ReThreading MadnessBernadine Fox143October 27, 2026Every two weeksrethreadingmadness.cahttps://www.spreaker.com/show/5675300/episodes/feedpodcastindex.org
Formed by Jesus PodcastPassion Creek Church143October 27, 2026Every two weeksformed-by-jesus-podcast.simplecast.comhttps://feeds.simplecast.com/HK8OHLqgpodcastindex.org
The EZ Struggle PodcastZAZ143October 27, 2026Every two weeksrss.com/podcasts/the-ez-strugglehttps://media.rss.com/the-ez-struggle/feed.xmlpodcastindex.org
Think DementiaAmy House C.D.P.143October 25, 2026Every two weeksthinkdementia.buzzsprout.comhttps://rss.buzzsprout.com/2170330.rsspodcastindex.org
Women's Wellness with Abbe FederCloud10143October 30, 2026Every two weekshttps://feeds.megaphone.fm/CTL1911597084podcastindex.org
Jayce Reads RomanceJayce143October 23, 2026Weeklyjaycereadsromance.com/podcasthttps://jaycereadsromance.squarespace.com/podcast?format=rsspodcastindex.org
The Body PodHailey Happens Fitness + Love By Laura143October 29, 2026Weeklyspreaker.com/podcast/the-body-pod--6344619https://www.spreaker.com/show/6344619/episodes/feedpodcastindex.org
Degrees of HealthBenjamin Hopkins143October 30, 2026Weeklyshows.acast.com/degreesofhealthpodcastindex.org
The Scales of WellnessKathy Bedward143October 26, 2026Weeklybuzzsprout.com/2293058https://rss.buzzsprout.com/2293058.rsspodcastindex.org
The Gaslit Truth PodcastDr. Teralyn Sell & Therapist Jenn Schmitz143October 27, 2026Weeklybuzzsprout.com/2287173https://rss.buzzsprout.com/2287173.rsspodcastindex.org
Beyond the Founder : Master Your LifeLuke Beastall143October 25, 2026Weeklymaster-your-life.co.ukhttps://rss.buzzsprout.com/2311426.rsspodcastindex.org
The Better Basics PodcastMatt Stone and Dylan Waldhuetter143October 28, 2026Weeklythebasictrainer.comhttps://anchor.fm/s/ef7e7bfc/podcast/rsspodcastindex.org
Save Yourself With Dr. Amy ShahDr. Amy Shah143October 28, 2026Weeklyamymdwellness.comhttps://feeds.megaphone.fm/ELYMN5266626860podcastindex.org
Musings and Modalities with Tristen Stawicki: Your Pragmatic Shaman BestieTristen Stawicki143October 22, 2026Weeklymusingsandmodalities.comhttps://www.spreaker.com/show/6095167/episodes/feedpodcastindex.org
Come As You Are PodcastAlly Hamilton143September 20, 2026Weeklyallyhamilton.yogisanonymous.com/podcastpodcastindex.org
Underneath the UnderneathOhmek143October 28, 2026Weeklyohmekliving.comhttps://feeds.captivate.fm/ohmek-underneath-the-underneath/podcastindex.org
Escape the ClinicKatie Bean143October 2, 2026Weeklyescape-the-clinic.captivate.fmhttps://feeds.captivate.fm/escape-the-clinic/podcastindex.org
AI in Medicine - curated summaries making complex issues easy to understandMike Rawson143October 31, 2026Weeklyai-in-medicine-podcast.vercel.apphttps://ai-in-medicine-podcast.vercel.app/feed.xmlpodcastindex.org
The Judd Lienhard PodcastJudd Lienhard143October 29, 2026Weeklyjuddlienhard.comhttps://rss.buzzsprout.com/2443113.rsspodcastindex.org
From The Ashes RadioRob , Producer Joe and The Rock143September 8, 2026Every two weeksaboutfaceradio.orghttps://anchor.fm/s/9d4065e4/podcast/rsspodcastindex.org
Peptide of the Week | Weight Loss, Health & WellnessJD Denham143October 29, 2026Weeklyspreaker.com/podcast/peptide-of-the-week--7447107https://anchor.fm/s/1058fab64/podcast/rsspodcastindex.org
Neuroscience Daily: 5-minute briefingpod pub143October 21, 2026Dailyhttps://feeds.transistor.fm/daily-neurosciencepodcastindex.org
Soulfull Sound PodcastSimone Niles142October 28, 2026Monthlysimoneniles.com/podcasts/soulfull-sound-podcasthttps://app.kajabi.com/podcasts/2147498165/feedpodcastindex.org
From the Inside Out: With Rivkah Krinsky and Eda SchottensteinRivkah and Eda142October 22, 2026Monthlyfromtheinsideout.buzzsprout.comhttps://rss.buzzsprout.com/804464.rsspodcastindex.org
Air Time Podcastjody wachniak142October 28, 2026Monthlyairtimepodcast.comhttps://airtimepodcast.libsyn.com/rsspodcastindex.org
Come Lose ItMatt Duncan142October 11, 2026Monthlycomeloseit.wordpress.comhttps://anchor.fm/s/2b270a30/podcast/rsspodcastindex.org
Kaleidoscope of PossibilitiesDr. Adriana Popescu142October 12, 2026Monthlykaleidoscopeofpossibilities.podbean.comhttps://feed.podbean.com/kaleidoscopeofpossibilities/feed.xmlpodcastindex.org
CCAirwavesThe Catholic Cemeteries Association142October 8, 2026Monthlyclecem.orghttps://rss.buzzsprout.com/814187.rsspodcastindex.org
OTR - Achieving Mental Health for RealRobert Adleman142October 20, 2026Monthlybobadleman.wixsite.com/otrmentalhealthhttps://feeds.captivate.fm/otr-achieving-mental/podcastindex.org
The Round 12 Show: MOTIVATIONAL MASTERYRoger B. Hamilton142October 18, 2026Monthlyround12resilience.podbean.comhttps://round12resilience.podbean.com/feed.xmlpodcastindex.org
Body Charge by Elektra MagnesiumDaniel142October 29, 2026Every two weeksspreaker.com/podcast/body-charge-by-elektra-magnesium--4857635https://www.spreaker.com/show/4857635/episodes/feedpodcastindex.org
Hunters HD Gold®, Behind the LensHunters HD Gold® - Brian Conley142October 28, 2026Every two weekshuntershdgold.comhttps://rss.buzzsprout.com/1808583.rsspodcastindex.org
The Vegan Beauty Power Lifestyle PodcastJessica Maria Britt142September 7, 2026Every two weeksredcircle.com/shows/the-vegan-beauty-power-lifestyle-podcasthttps://feeds.redcircle.com/885182bb-371d-4a91-8d08-c057fabac8c0podcastindex.org
Fairway Performance PodcastShaun Diachkoff142October 19, 2026Every two weeksfairwayperformance.comhttps://rss.buzzsprout.com/2017271.rsspodcastindex.org
Live Your Best MidlifeJill Lewis142October 14, 2026Every two weeksjilllewisliving.comhttps://anchor.fm/s/be22ee08/podcast/rsspodcastindex.org
What the Health Just Happened?ET Media, LLC142October 19, 2026Every two weeksrss.com/podcasts/whatthehealthjusthappenedhttps://media.rss.com/whatthehealthjusthappened/feed.xmlpodcastindex.org
The OBservations PodcastAmerican Association of Pro-Life Obstetricians and Gynecologists (AAPLOG)142October 29, 2026Every two weeksbuzzsprout.com/2171868https://rss.buzzsprout.com/2171868.rsspodcastindex.org
The Fitness 4 Back Pain PodcastWilliam Richards142August 27, 2026Every two weeksfitness4backpain.mykajabi.com/podcasts/the-fitness-4-back-pain-podcasthttps://app.kajabi.com/podcasts/2147527213/feedpodcastindex.org
In a Nutshell: The Plant-Based Health Professionals UK PodcastClare Day and Daisy Lund142October 28, 2026Every two weekspodcasters.spotify.com/pod/show/clare-day2https://anchor.fm/s/e0ec201c/podcast/rsspodcastindex.org
The Chad Franco PodcastChad Franco142October 27, 2026Every two weekspodcasters.spotify.com/pod/show/chad-francohttps://anchor.fm/s/e3e5ff2c/podcast/rsspodcastindex.org
Don't Be Caught Dead: Grief, Loss, Death Literacy and Getting PreparedHosted by Catherine Ashton, founder of Australian social enterprise Critical Info. Learn more: www.criticalinfo.com.au142October 28, 2026Weeklydontbecaughtdead.buzzsprout.comhttps://rss.buzzsprout.com/2287809.rsspodcastindex.org
Hypnotic Authenticity | Coming Home to YourselfAuthentic Life | Clinical Hypnotherapist142October 5, 2026Weeklyauthenticlifecoaching.chhttps://anchor.fm/s/f02e3010/podcast/rsspodcastindex.org
The Intelligence For Your Life Podcast with John TeshJohn Tesh142October 27, 2026Weeklypodcast.tesh.comhttps://rss.buzzsprout.com/2379393.rsspodcastindex.org
Emily the Mystic ShowEmily Logan Lewis142October 28, 2026Weeklyemilythemystic.com/podcasts/emily-the-mystic-showhttps://app.kajabi.com/podcasts/2147707657/feedpodcastindex.org
Nutrition for MamasBrooke MIller, RD, CLC142October 27, 2026Weeklythepostpartumshift.podbean.comhttps://feed.podbean.com/thepostpartumreset/feed.xmlpodcastindex.org
The Physique ForumThe Physique Forum142October 27, 2026Every two weekspodcasters.spotify.com/pod/show/thephysiqueforumhttps://anchor.fm/s/e735a4d4/podcast/rsspodcastindex.org
Ride and Laugh MTB PodcastDan & Sage142October 28, 2026Weeklyrideandlaugh.podbean.comhttps://feed.podbean.com/rideandlaugh/feed.xmlpodcastindex.org
AtalantaAtalanta142October 26, 2026Weeklypodcasters.spotify.com/pod/show/rad1https://anchor.fm/s/f36372a4/podcast/rsspodcastindex.org
Eastern Shore TalkJay Watson142October 27, 2026Weeklyeasternshoretalk.orghttps://anchor.fm/s/f2dc0648/podcast/rsspodcastindex.org
Zone2Speak PodcastJuliana142October 29, 2026Weeklyzone2speak.podbean.comhttps://feed.podbean.com/zone2speak/feed.xmlpodcastindex.org
News for the Ages by Rethinking Aging ClubLinda Sherman and Ray Gordon142October 28, 2026Weeklyboomertechtalk.comhttps://rss.buzzsprout.com/2370721.rsspodcastindex.org
The Crystal Bar PodcastClaire Titmus & The Crystal Bar142October 28, 2026Weeklythecrystalbar.podbean.comhttps://feed.podbean.com/thecrystalbar/feed.xmlpodcastindex.org
The First Seven YearsDr. Murray Clarke & Bryce Wylde142October 30, 2026Weeklyrss.com/podcasts/the-first-seven-yearshttps://media.rss.com/the-first-seven-years/feed.xmlpodcastindex.org
Total Disruption PodcastMichael Libercci142October 29, 2026Weeklytotal-disruption-podcast.simplecast.comhttps://feeds.simplecast.com/s2cuPj_3podcastindex.org
8158 Podcast: Stories of Sacrifice8158 Podcast142October 25, 2026Weekly8158podcast.comhttps://api.riverside.fm/hosting/xdac6asa.rsspodcastindex.org
Awakening AirwavesY Williams142October 30, 2026Weeklyspreaker.com/podcast/awakening-airwaves--6619020https://www.spreaker.com/show/6619020/episodes/feedpodcastindex.org
In a Nutshell: The Plant-Based Health Professionals UK PodcastInANutshell142October 28, 2026Every two weeksspreaker.com/podcast/in-a-nutshell-the-plant-based-health-professionals-uk-podcahttps://www.spreaker.com/show/6687793/episodes/feedpodcastindex.org
Fasting SpacePhil Zimmermann, MD142October 30, 2026Several times a weeksimplefasting.comhttps://feeds.transistor.fm/fasting-spacepodcastindex.org
H.O.P.E - Hang On Pain EndsAlana Michaels142October 4, 2026Several times a weekrss.com/podcasts/hang-on-pain-endshttps://media.rss.com/hang-on-pain-ends/feed.xmlpodcastindex.org
The Ninja FamPlay.Works142October 29, 2026Weeklyninjakidz.comhttps://feeds.megaphone.fm/IKLKT4008907977podcastindex.org
TAKE A DEEP BREATHMike Maher141October 15, 2026Monthlybuzzsprout.com/1171214https://rss.buzzsprout.com/1171214.rsspodcastindex.org
Sauna TalkSaunaTimes141October 23, 2026Monthlysaunatimes.libsyn.comhttps://saunatimes.libsyn.com/rsspodcastindex.org
Birth MattersLisa Taylor - Birth Matters NYC Childbirth Education & Labor Support141October 24, 2026Monthlybirthmattersshow.comhttps://rss.buzzsprout.com/310952.rsspodcastindex.org
HONEY on the SWORDMarini Facey141October 11, 2026Monthlypodcasters.spotify.com/pod/show/marini-faceyhttps://anchor.fm/s/24a6015c/podcast/rsspodcastindex.org
The Richard Nicholls Mental Health PodcastRichard Nicholls141October 30, 2026Monthlyrichardnicholls.nethttps://feeds.feedburner.com/richardnichollspodcastindex.org
The Revital Health PodcastRevital Health Podcast141October 28, 2026Monthlyrevitalhealth.com.au/category/the-revital-health-podcasthttps://feeds.captivate.fm/the-revital-health/podcastindex.org
Infertility FeelingsJesse and Doug from Uniquely Knitted141October 26, 2026Every two weeksinfertilityfeelingspodcast.buzzsprout.comhttps://rss.buzzsprout.com/1357159.rsspodcastindex.org
Higher Self with Carina ShinesCarina Shines141October 28, 2026Every two weeksmatriarchmedicine.shophttps://rss.buzzsprout.com/1593913.rsspodcastindex.org
The Empowered Feminine With Ciara FoyCiara Foy141September 16, 2026Every two weeksciarafoy.comhttps://rss.buzzsprout.com/1359526.rsspodcastindex.org
From Darkness to Life Podcast: Stories of Recovery & ResilienceOur Collective Journey141October 29, 2026Every two weeksredcircle.com/shows/from-darkness-to-lifehttps://feeds.redcircle.com/3d4c31d4-8cc0-42d9-bbde-f53aef26717dpodcastindex.org
Purpose Served PodcastDarryl Wingfield141October 27, 2026Every two weekspurposeserved.comhttps://rss.buzzsprout.com/1425349.rsspodcastindex.org
Keeping Ashland HealthyWMAN AM & FM (WMAN-AM)141September 17, 2026Every two weeksiheart.com/podcast/82735053https://www.spreaker.com/show/4932225/episodes/feedpodcastindex.org
The Cancer Liberation ProjectHayley Dubin141October 15, 2026Every two weeksredcircle.com/shows/the-cancer-liberation-projecthttps://feeds.redcircle.com/35a8f34b-49ea-46d9-9987-86798c9c4417podcastindex.org
Up Your Total GlowRuth Balsiger141October 17, 2026Every two weeksithriveforhealth.comhttps://rss.buzzsprout.com/1848014.rsspodcastindex.org
The Resilient Living PodcastTerrilyn Minnifield141October 28, 2026Every two weeksterrilynminnifield.comhttps://rss.buzzsprout.com/1835829.rsspodcastindex.org

Next 500 shows

Updated November 3, 2026. Read from Podcast Index. Free for any use (the Podcast Index public database). Episode counts and dates are as each show's feed reports them to the Podcast Index. How often a show publishes is the average gap between its first and its latest episode. The index keeps at most 1,000 episodes of a show. Owner names are printed as the feed prints them. Contact addresses are not shown here. Free to reuse with credit to SpecStream under CC BY 4.0. Spot a wrong value? Write to [email protected] with the link to this page.