Skip to the page
Get started – free

Data / Podcasts / Alternative / English

Alternative podcasts in English: 3,293 active shows (2026), page 2

3,293 alternative podcasts in English published an episode in the last 90 days to October 31, 2026. 1,194 publish at least weekly and 1,123 published in the last 7 days. The list gives each show's owner, episode count, last episode, publishing frequency, website and feed, read from the Podcast Index on November 3, 2026.

SpecStream is the live web data engine for teams and agents. It reads the Podcast Index every day, and this page is that reading. Ask for the shows you want by topic, language and how often they publish, with each show's contact, and new and changed shows arrive in your sheet, CRM, Slack or agent.

Get alternative podcasts in EnglishWatch for new shows

Active alternative podcasts in English, 501 to 1,000

ShowOwnerEpisodesLast episodePublishesWebsiteFeedSource
The Rooted DC- Reclaim Your LegitimacyDr. Alexandra Swenson-Ridley245October 22, 2026Every two weeksrootedpractice.cohttps://feeds.alitu.com/49644361podcastindex.org
Sleep Sounds - 12 Hourssolgoodmedia.com245October 31, 2026Weeklyspreaker.com/podcast/sleep-sounds-12-hours--6184297https://www.spreaker.com/show/6184297/episodes/feedpodcastindex.org
Woven Well: Natural Fertility PodcastCaitlin Estes244October 30, 2026Weeklywovenfertility.comhttps://rss.buzzsprout.com/1901945.rsspodcastindex.org
Sh!t That Goes On In Our HeadsBleav + G-Rex and Dirty Skittles244October 29, 2026Weeklybleav.com/shows/shit-that-goes-on-in-our-headshttps://feeds.simplecast.com/92MthJiEpodcastindex.org
Not Your Mother's Menopause with Dr. Fiona Lovely | Perimenopause and Menopause SupportDr. Fiona Lovely243October 27, 2026Monthlydrlovely.comhttps://feeds.libsyn.com/77629/rsspodcastindex.org
The Wholeness NetworkMind Body Spirit.fm243October 29, 2026Every two weeksmindbodyspirit.fm/shows/the-wholeness-network-podcasthttps://feeds.megaphone.fm/thewholenessnetworkpodcastindex.org
PRETTY WELL - Anti-Aging, Beauty, Balanced Hormones, Inflammation, Gut Health, IBS, Evidence-basedLisa Smith, MS, RD, LDN |Functional Wellness| Holistic Gut:Mitochondria Expert243October 28, 2026Weeklydlbrsmith.podbean.comhttps://feed.podbean.com/dlbrsmith/feed.xmlpodcastindex.org
Coffee With Hilary and Les from State of Mind Hypnosis and Training CentreHilary & Les243August 20, 2026Weeklysomhypnosis.comhttps://rss.buzzsprout.com/1829917.rsspodcastindex.org
Inspire Health PodcastDr. Jason Loken, ND242October 26, 2026Every two weeksinspirehealthpodcast.comhttps://drjasonloken.libsyn.com/rsspodcastindex.org
Unshakeable Health with Thomas Hemingway, M.D.Thomas Hemingway, M.D.242October 29, 2026Every two weeksthomashemingway.buzzsprout.comhttps://rss.buzzsprout.com/912208.rsspodcastindex.org
The Pleasure Project with Dana Skoglunddanaskoglund242September 29, 2026Weeklydanaskoglund.comhttps://podcasts.helloaudio.fm/podcast/4faab321-506f-4790-b579-ce3a40dacecc/tJMm5rjdYPpodcastindex.org
BetterHealthGuy PodcastScott Forsgren, FDN-P241October 19, 2026Every two weeksbetterhealthguy.comhttps://betterhealthguy.libsyn.com/rsspodcastindex.org
The PricePlow PodcastSupplement Industry Thought Leaders241October 29, 2026Every two weeksblog.priceplow.com/podcasthttps://blog.priceplow.com/feed/podcastpodcastindex.org
Dr. Eric's Relentless VitalityDr. Eric - The Fitness Physician240October 26, 2026Every two weeksdrericprimex.comhttps://anchor.fm/s/d7dd3b0/podcast/rsspodcastindex.org
Women's Power to Heal Mother Earth!Maya239October 27, 2026Every two weeksmayatiwari.comhttps://rss.buzzsprout.com/989500.rsspodcastindex.org
Mindset CheckMy Friend Mesha239October 30, 2026Weeklymyfriendmesha.comhttps://rss.buzzsprout.com/1851685.rsspodcastindex.org
Peak Human - Unbiased Nutrition Info for Optimum Health, Fitness & LivingBrian Sanders238October 29, 2026Every two weekspeak-human.comhttps://peakhuman.libsyn.com/rsspodcastindex.org
Sol Good Sounds - 12 Hourssolgoodmedia.com238October 31, 2026Weeklyspreaker.com/podcast/sol-good-sounds-12-hours--6184304https://www.spreaker.com/show/6184304/episodes/feedpodcastindex.org
The Raelan Agle PodcastRaelan238October 26, 2026Several times a weekbuzzsprout.com/2393184https://rss.buzzsprout.com/2393184.rsspodcastindex.org
Bird Sounds in Stereo: Immersive Birdsong and Nature Ambience for Sleep, Relaxation, Meditation, and Stress ReliefNatural Podcasts238August 14, 2026Dailynaturalpodcasts.comhttps://feeds.megaphone.fm/bird-sounds-in-stereopodcastindex.org
What the Nell!?Nell Tice237October 27, 2026Weeklyenticeing-media.kit.com/whatthenellpodcasthttps://feeds.captivate.fm/what-the-nell/podcastindex.org
12 Hour SoundsAudiobooks237October 31, 2026Weeklyspreaker.com/podcast/12-hour-sounds--6183018https://www.spreaker.com/show/6183018/episodes/feedpodcastindex.org
ReInvent HealthcareDr. Ritamarie Loscalzo236October 28, 2026Weeklyreinventhealthcare.comhttps://feeds.captivate.fm/reinvent-healthcare/podcastindex.org
First ThisKathryn Nicolai236October 26, 2026Weeklyfirstthispodcast.comhttps://feeds.simplecast.com/IpzeEl8Upodcastindex.org
12 Hour Sleep Soundssolgoodmedia.com236October 31, 2026Weeklyspreaker.com/podcast/12-hour-sleep-sounds--6184285https://www.spreaker.com/show/6184285/episodes/feedpodcastindex.org
The Dr. Kinney ShowDr. Erin Kinney235October 19, 2026Every two weeksdrerinkinney.com/the-dr-kinney-showhttps://rss.buzzsprout.com/2088509.rsspodcastindex.org
The Experience Miracles™ PodcastDr. Tony Ebel235October 27, 2026Weeklybuzzsprout.com/2272506https://rss.buzzsprout.com/2272506.rsspodcastindex.org
Terrain TheoryTerrain Theory Ben234October 30, 2026Weeklyterraintheory.net/blogs/podcasthttps://rss.buzzsprout.com/1926796.rsspodcastindex.org
The First Lady of Nutrition Podcast with Ann Louise Gittleman, Ph.D., C.N.S.Ann Louise Gittleman, Ph.D., C.N.S.233October 28, 2026Every two weeksannlouise.comhttps://annlouise.com/feed/podcast/podcastindex.org
The Eczema PodcastAbby Tai233October 22, 2026Every two weekstheeczemapodcast.libsyn.com/podcasthttps://theeczemapodcast.libsyn.com/rsspodcastindex.org
Meditations - Abigail Rose GazdaAbigail Rose Gazda233October 30, 2026Weeklypodcast.show/3562521https://feeds.blubrry.com/feeds/3562521.xmlpodcastindex.org
Healthcare UprisingHeather Pierce and Jeremy Carr232October 30, 2026Several times a weekhealthcareuprising.podbean.comhttps://feed.podbean.com/healthcareuprising/feed.xmlpodcastindex.org
Thrive and Aligned HealingDr. Carmen Jones ND and Coach Kimberly Jarman231October 30, 2026Every two weekskimberlyjarmancoaching.comhttps://anchor.fm/s/12ef1afc/podcast/rsspodcastindex.org
Stream of SubconsciousnessLincoln Stoller PhD CHt CCPCPr231October 29, 2026Every two weeksmindstrengthbalance.substack.com/podcastpodcastindex.org
Perimenopausal Conversations for Busy Women; navigating midlife, wellness, and hormoneswith Meg Fittsgill and Heather Skold231October 23, 2026Weeklyessentialoilconversations.comhttps://anchor.fm/s/6bd5ad84/podcast/rsspodcastindex.org
Ready Set ReikiTracy searight231October 25, 2026Weeklybuzzsprout.com/2162482https://rss.buzzsprout.com/2162482.rsspodcastindex.org
Sol Luckman UncensoredSol Luckman231October 29, 2026Weeklysolluckman.substack.com/podcastpodcastindex.org
Breast Cancer Conqueror® PodcastDr. Veronique Desaulniers230August 24, 2026Every two weeksbreastcancerconqueror.com/podcasthttps://breastcancerconqueror.libsyn.com/rsspodcastindex.org
Thyroid Mystery Solved: Hashimoto's and Hypothyroidism RevealedInna Topiler - MS, CNS230October 29, 2026Every two weeksinnatopiler.comhttps://feeds.transistor.fm/health-mysteries-solved-thyroid-and-hashimotos-revealedpodcastindex.org
Medical Millionaire PodcastCameron Hemphill230October 28, 2026Every two weeksspreaker.com/podcast/medical-millionaire-podcast--4747916https://www.spreaker.com/show/4747916/episodes/feedpodcastindex.org
White NoiseSol Good Media230October 27, 2026Weeklyspreaker.com/show/white-noise_11https://feeds.megaphone.fm/OOLDL8511953044podcastindex.org
Level Up and LIVESean Meyers230October 27, 2026Weeklylevelupcoaching23.podbean.comhttps://feed.podbean.com/levelupcoaching23/feed.xmlpodcastindex.org
On Your MindTimothy J. Hayes, Psy.D.229October 13, 2026Every two weeksjourneysdream.org/podcasthttps://feeds.podetize.com/rss/b0_sU-V6Clpodcastindex.org
Peter's PodcastPeter Ferko229October 7, 2026Every two weekspeterferko.comhttps://feeds.simplecast.com/wTMmIARwpodcastindex.org
Homeopathy 247 PodcastMary Greensmith229October 29, 2026Weeklysites.libsyn.com/419117https://feeds.libsyn.com/419117/rsspodcastindex.org
The Habit Thrive Podcast ~ Self Care Habits, Mindfulness & Wellness Routines for Women 50 & Beyondactiveoptionsbylorrie229October 31, 2026Weeklylorriemickelson.comhttps://podcasts.helloaudio.fm/podcast/31b8396b-7339-47a5-93a3-f9aefd7e8c5a/idCpX3rcg1podcastindex.org
The Plant Path: Clinical Herbalism, Medical Astrology & Spagyric AlchemySajah Popham228October 28, 2026Every two weeksevolutionaryherbalism.comhttps://theplantpath.libsyn.com/rsspodcastindex.org
Sleepy Stories: To help you sleepSleepy Studios228October 30, 2026Weeklyspreaker.com/show/sleepy-stories-to-help-you-sleephttps://www.spreaker.com/show/5818206/episodes/feedpodcastindex.org
The Third House Astrology and WellnessErica Barnes227October 30, 2026Weeklythethirdhouse.orghttps://anchor.fm/s/e8e27a14/podcast/rsspodcastindex.org
Your Health. Your Story.Innovative Medicine226October 22, 2026Every two weeksinnovativemedicine.comhttps://rss.buzzsprout.com/678623.rsspodcastindex.org
Integrative Lyme Solutions with Dr. KarlfeldtDr. Michael Karlfeldt226October 26, 2026Every two weeksintegrative-lyme-solutions-with-dr-karlfeldt.castos.comhttps://feeds.transistor.fm/integrative-lyme-solutions-with-dr-karlfeldtpodcastindex.org
Supernormalized PodcastSupernormalized Podcast226October 13, 2026Weeklysupernormalized.comhttps://feeds.castos.com/r4n40podcastindex.org
HYDRATE with Tracy DuhsTracy Duhs225October 28, 2026Every two weekstracyduhs.comhttps://anchor.fm/s/105df6fb4/podcast/rsspodcastindex.org
Relaxations, Breathwork, & Meditations by Yoga for SclerodermaAlexis Harrison, Pat McMillan, Kathy Randolph225October 22, 2026Every two weeksyogaforscleroderma.comhttps://rss.buzzsprout.com/1314106.rsspodcastindex.org
Spirit SpeakeasyJoy Giovanni225October 30, 2026Weeklyjoyfulmedium.comhttps://rss.buzzsprout.com/2084888.rsspodcastindex.org
Soulful Sharing CircleTara Stricker- TSW225October 11, 2026Every two weekstaratsw.substack.com/podcastpodcastindex.org
Root Cause Revolution PodcastAudrey Christie, ND-trad, MSN, RN224October 30, 2026Every two weeksaudreychristie.com/bloghttps://rss.buzzsprout.com/1535428.rsspodcastindex.org
Live Unrestricted - The Intuitive Eating & Food Freedom PodcastSabrina Magnan224October 28, 2026Weeklyliveunrestrictedpodcast.buzzsprout.comhttps://rss.buzzsprout.com/2062269.rsspodcastindex.org
Mainly Plants PodcastRyan Furman223October 22, 2026Monthlymainlyplants.comhttp://feeds.feedburner.com/mainlyplants/yAOcpodcastindex.org
Recovery Matters! PodcastCCAR223October 20, 2026Every two weeksccar.ushttps://feeds.simplecast.com/sV0XD3iYpodcastindex.org
Frequency Specific Microcurrent PodcastDr. Carolyn McMakin223September 30, 2026Every two weeksfrequencyspecific.comhttps://frequencyspecific.libsyn.com/rsspodcastindex.org
Mind Your Own Karma - Beyond The BandageMelissa Brunetti223October 20, 2026Every two weeksmindyourownkarma.comhttps://anchor.fm/s/70b758c0/podcast/rsspodcastindex.org
SeamossgirliesiHeartPodcasts222October 28, 2026Every two weeksinstagram.com/seamossgirlieshttps://www.omnycontent.com/d/playlist/e73c998e-6e60-432f-8610-ae210140c5b1/8feb1906-956f-4a94-b4ee-b3b1015f4464/35551d09-01b8-4a8d-8461-b3b1015f449c/podcast.rsspodcastindex.org
Venus & Vesta Evolutionary AstrologyAnn-Louise Holland222October 30, 2026Weeklyvenusandvesta.comhttps://feeds.captivate.fm/venus-vesta/podcastindex.org
Funny Till It's NotJoshua Albanese222October 28, 2026Weeklyredcircle.com/shows/funny-till-its-nothttps://feeds.redcircle.com/a4338fbf-0b92-49f3-b803-60cee64b9942podcastindex.org
Manders MindsetAmanda Russo222October 5, 2026Weeklymandersmindset.buzzsprout.comhttps://rss.buzzsprout.com/2233710.rsspodcastindex.org
The Hippie Moms PodcastBecky Wells221September 25, 2026Every two weeksthe-hippiemoms-podcast.simplecast.comhttps://feeds.simplecast.com/qIt9_E0Fpodcastindex.org
Cosmic Navigator Astrology ShowGahl Sasson221October 25, 2026Every two weekscosmicnavigator.compodcastindex.org
Motherhood Alliance PodcastMotherhood Alliance221October 26, 2026Weeklymotherhoodalliance.podbean.comhttps://api.riverside.fm/hosting/kHY1zM1n.rsspodcastindex.org
Sacred Feminine PowerEmmi Mutale, Feminine Revered220October 8, 2026Every two weeksfemininerevered.comhttps://rss.buzzsprout.com/1038388.rsspodcastindex.org
Sober EdgeTeri Patterson220October 21, 2026Every two weeksthesobernutritionist.comhttps://soberedgepodcast.libsyn.com/rsspodcastindex.org
The Peptide PodcastThe Peptide Queen219October 29, 2026Weeklypepties.comhttps://feeds.libsyn.com/417458/rsspodcastindex.org
The Great Birth RebellionDr Melanie Jackson219October 25, 2026Weeklymelaniethemidwife.com/podcasts/the-great-birth-rebellionhttps://rss2.flightcast.com/jcult9wy1ey81bgbiczdjy68.xmlpodcastindex.org
The Holistic Fertility ShowMike Berkley219October 28, 2026Several times a weekberkleycenter.comhttps://rss.buzzsprout.com/2424689.rsspodcastindex.org
Healing Mile | Walking for Mental Health, Happiness & Personal GrowthCarrie King | Healing Mile219August 28, 2026Several times a weekthehealingmile.comhttps://rss.buzzsprout.com/2497494.rsspodcastindex.org
Christian Healthy Lifestyle: Health Tips That Promote Wellness - Longevity - Fitness - Mental Health and Spiritual GrowthDavid Sandstrom218September 30, 2026Every two weekschristianhealthylifestyle.mykajabi.com/podcasts/christian-healthy-lifestyle-healhttps://app.kajabi.com/podcasts/2147953281/feedpodcastindex.org
The Joanne Avison PodcastJoanne Avison218October 30, 2026Every two weeksjoanneavison.comhttps://rss.buzzsprout.com/1262273.rsspodcastindex.org
The DNA Talks PodcastThe DNA Company218October 28, 2026Every two weeksbuzzsprout.com/1870029https://rss.buzzsprout.com/1870029.rsspodcastindex.org
Enlightened Empowered Evolved PodcastLoot Bryon Smith218October 22, 2026Weeklyyoutube.com/@333empowerhttps://www.podserve.fm/series/rss/6950/enlightened-empowered-evolved-podcast.rsspodcastindex.org
The Observatory | Discovery of Consciousness & AwarenessNC Productions www.NCP.media216October 29, 2026Weeklyspreaker.com/s/5BqDuRHy1U9Whttps://www.spreaker.com/show/5655534/episodes/feedpodcastindex.org
Delivering HealthJohn Neustadt ND215October 30, 2026Every two weeksnbihealth.comhttps://deliveringhealth.libsyn.com/rsspodcastindex.org
The Art Of Listening To Your BodyJin Ong215October 27, 2026Every two weekstheartoflisteningtoyourbody.comhttps://feed.pod.co/theartoflisteningtoyourbodypodcastindex.org
The Self Help AntidoteBobby Cappuccio215October 28, 2026Every two weekstheselfhelpantidote.buzzsprout.comhttps://rss.buzzsprout.com/1667158.rsspodcastindex.org
Reproductive RebelAdrienne Irizarry, HWH215October 27, 2026Weeklymoonessence.lifehttps://rss.buzzsprout.com/2087965.rsspodcastindex.org
Energy Work: Clear Your Blocks, Activate Your Power, Manifest Your Dream LifeGeorge Lizos214October 30, 2026Every two weeksgeorgelizos.com/podcastpodcastindex.org
HER HOLISTIC HEALING, Christian Wellness, Holistic Health, Autoimmune Disease, Exhaustion, Faith-Based HealthAlexandra Yu-Christian Health Coach, Registered Nurse, Faith & Holistic Health214October 21, 2026Weeklyherholistichealing.comhttps://feed.podbean.com/herholistichealing/feed.xmlpodcastindex.org
HER HOLISTIC HEALING, Christian Wellness, Holistic Health, Autoimmune Disease, Exhaustion, Faith-Based HealthAlexandra Yu-Christian Health Coach, Registered Nurse, Faith & Holistic Health214October 21, 2026Weeklyherholistichealing.comhttps://herholistichealing.podbean.com/feed.xmlpodcastindex.org
The Well Nourished PodcastMelissa Eich214October 29, 2026Weeklymelissaeichcoaching.com/the-podcasthttps://rss.buzzsprout.com/2230541.rsspodcastindex.org
For the Love of Hormones- Miscarriage, Hormone Balance, Progesterone, TTC, Cycle Tracking, Conception, Holistic HealthBekah Yawn I Christian Hormone & Ovulation Coach, FEMM Educator, Certified Doula, Fiat Institute214October 29, 2026Weeklybekahyawn.comhttps://api.riverside.com/hosting/qYTazXQ6.rsspodcastindex.org
Live Train PerformShaun Kober213October 16, 2026Every two weekslivetrainperform.buzzsprout.comhttps://rss.buzzsprout.com/1082945.rsspodcastindex.org
#moldfinders: RADIOBrian Karr212October 7, 2026Every two weekspodcasters.spotify.com/pod/show/moldfindershttps://anchor.fm/s/214f3d70/podcast/rsspodcastindex.org
Good PizzZa PodcastJPeezy212October 27, 2026Weeklygoodpizzza.comhttps://rss.buzzsprout.com/1968982.rsspodcastindex.org
Lifeline to VitalityJarek Esarco, DC, CACCP211October 6, 2026Every two weeksohiospecific.comhttps://rss.buzzsprout.com/340628.rsspodcastindex.org
Knocked Up: All About Fertility and Women's HealthWomen's Health Melbourne211October 25, 2026Every two weekswomenshealthmelbourne.com.au/category/podcasthttps://anchor.fm/s/114e45c7c/podcast/rsspodcastindex.org
Making Life BrighterWinifred Adams211September 3, 2026Monthlysites.libsyn.com/597950https://rss.libsyn.com/shows/597950/destinations/5201310.xmlpodcastindex.org
AGELESS HEALTH® with Dr. Tom Roselle, DCDr. Tom Roselle, DC211October 25, 2026Weeklydrtomroselle.com/ageless-health-podcasthttps://feeds.libsyn.com/453225/rsspodcastindex.org
Align + Attract with Kerry RowettKerry Rowett211October 1, 2026Every two weeksalignandattract.comhttps://rss.buzzsprout.com/1540993.rsspodcastindex.org
Trying To Be Better with Joel and SteveTrying To Be Better Podcast211October 11, 2026Every two weeksttbbpodcast.podbean.comhttps://feed.podbean.com/ttbbpodcast/feed.xmlpodcastindex.org
(cosmic) flow states w/ Amanda BarnettBARNEY + FLOW | Living Into The New Paradigm211October 28, 2026Every two weeksbarney41g5v.substack.com/podcastpodcastindex.org
Stress Management + Resilience Tools for Your Happified LifeSusi Vine210October 29, 2026Every two weekshappified.simplecast.comhttps://feeds.simplecast.com/9dn8dkodpodcastindex.org
The Overwatch Collective PodcastThe Overwatch Collective209October 30, 2026Every two weekstheoverwatchcollective.comhttps://rss.buzzsprout.com/1794686.rsspodcastindex.org
The Reverse Aging Club with Meredith OkeThe Reverse Aging Club209October 29, 2026Weeklyreverseaging.clubhttps://feeds.captivate.fm/the-reverse-aging-club/podcastindex.org
Decoding HealthDr. Urban A. Kiernan209October 26, 2026Weeklydecodinghealthpocast.comhttps://rss.buzzsprout.com/2332406.rsspodcastindex.org
The life of a Third Culture Kid therapistDr Rachel Cason208October 30, 2026Every two weeksexplorelifestory.compodcastindex.org
The Everyday Health StruggleOkechukwu Okoro208October 28, 2026Dailypodcasters.spotify.com/pod/show/okechukwu-okoro0https://anchor.fm/s/11139017c/podcast/rsspodcastindex.org
Deep Sleep Tibetan Singing Bowls SoundsJosh Linsk207September 3, 2026Dailydeepsleeppodcasts.comhttps://feeds.megaphone.fm/deep-sleep-tibetan-singing-bowls-soundspodcastindex.org
The Ultimate Pregnancy Prep PodcastNora DeBora206October 25, 2026Every two weekssites.libsyn.com/398336https://feeds.libsyn.com/398336/rsspodcastindex.org
Living A Full LifeFull Life Chiropractic206October 27, 2026Weeklylivingafulllife.buzzsprout.comhttps://rss.buzzsprout.com/2079037.rsspodcastindex.org
Harnessing Happiness with Sarah J NaylorSarah J Naylor206August 25, 2026Every two weeksharnessinghappiness.transistor.fmhttps://feeds.transistor.fm/harnessing-happiness-with-sarah-j-naylorpodcastindex.org
OTs In Pelvic HealthLindsey Vestal205October 26, 2026Weeklybuzzsprout.com/1971868https://rss.buzzsprout.com/1971868.rsspodcastindex.org
Foodnourish Deep DivesPavlos Giorkas205October 23, 2026Several times a weekfoodnourish.nethttps://www.spreaker.com/show/6602003/episodes/feedpodcastindex.org
First Time Mum's ChatHelen Thompson204August 26, 2026Every two weeksredcircle.com/shows/first-time-mums-chathttps://feeds.redcircle.com/2315904d-2cca-420c-8e88-f3ae02d94847podcastindex.org
Dr. Brendan McCarthyDr. Brendan McCarthy204September 17, 2026Weeklybrendanmccarthypodcast.podbean.comhttps://brendanmccarthypodcast.podbean.com/feed.xmlpodcastindex.org
Dr. Brendan McCarthyDr. Brendan McCarthy204September 17, 2026Weeklybrendanmccarthypodcast.podbean.comhttps://feed.podbean.com/brendanmccarthypodcast/feed.xmlpodcastindex.org
Working in YogaRebecca Sebastian204October 29, 2026Every two weeksworkinginyoga.com/podcasthttps://panda-sturgeon-agf9.squarespace.com/podcast?format=rsspodcastindex.org
Occupy HealthVoiceAmerica202October 30, 2026Monthlysites.libsyn.com/556853https://rss.libsyn.com/shows/556853/destinations/4809081.xmlpodcastindex.org
The Energy Workz PodcastTanya Ormsby202October 7, 2026Every two weekstanyaormsby.comhttps://rss.buzzsprout.com/860593.rsspodcastindex.org
SPA HIVEJulie Pankey202October 30, 2026Every two weeksjulie4b.podbean.comhttps://feed.podbean.com/julie4b/feed.xmlpodcastindex.org
Heal Yourself. Change Your Life™Brandy Gillmore201October 29, 2026Every two weeksbrandygillmore.com/podcast-episodeshttps://healyourself.libsyn.com/rsspodcastindex.org
Doulas of the RoundtableAngela Horn201October 21, 2026Every two weeksdoulasoftheroundtable.comhttps://doulasoftheroundtable.libsyn.com/rsspodcastindex.org
Mindful Drinking and Moderation in Midlife: How to Drink Less, On Your TermsDenise Hamilton-Mace | Mindful Drinking Mentor Writer, Speaker & Coach201October 28, 2026Weeklylownodrinker.comhttps://rss.buzzsprout.com/2229527.rsspodcastindex.org
Spiritual MixtapeSpiritual Mixtape201October 29, 2026Weeklyspiritualmixtape.comhttps://anchor.fm/s/1174e97ac/podcast/rsspodcastindex.org
STEM-TalkDawn Kernagis and Ken Ford200October 26, 2026Monthlyihmc.us/stemtalkhttps://www.ihmc.us/stemtalk/feed/podcast/podcastindex.org
The Awakening Quest: 1001 Ways to True Power & Conscious Elevated LivingLiz Gracia200October 27, 2026Every two weeksthemindbodyspiritnetwork.comhttps://rss.buzzsprout.com/456295.rsspodcastindex.org
WAKE UP! with JoniJoni Caldwell Lerner200October 29, 2026Every two weekswakeupwithjoni.comhttps://spiritualaliveness.libsyn.com/rsspodcastindex.org
Keen on Yoga PodcastKeen on Yoga Podcast200October 25, 2026Weeklykeenonyoga.comhttps://keenonyogapodcast.libsyn.com/rsspodcastindex.org
Lose Your Cravings Podcast with Keysa AmaroKeysa Amaro200October 22, 2026Every two weekslose-your-cravings-podc.captivate.fmhttps://feeds.captivate.fm/lose-your-cravings-podc/podcastindex.org
Herbs with RosaleeRosalee de la Forêt200October 28, 2026Weeklyherbs-with-rosalee.captivate.fmhttps://feeds.captivate.fm/herbs-with-rosalee/podcastindex.org
The Out of the Cave PodcastLisa Schlosberg200October 26, 2026Every two weeksoutofthecave.healthhttps://anchor.fm/s/69427110/podcast/rsspodcastindex.org
STEMTalks Archive - IHMC | Institute for Human & Machine Cognition200October 26, 2026Monthlyihmc.us/stemtalkhttps://www.ihmc.us/stemtalk/feed/podcastindex.org
Touched By A HorseMelisa Pearce200October 29, 2026Every two weekstouchedbyahorse.libsyn.com/websitehttps://feeds.captivate.fm/touched-by-a-horse/podcastindex.org
The Dr. Ardis Show PodcastDr Bryan Ardis200October 28, 2026Every two weeksthedrardisshow.libsyn.com/websitehttps://feeds.libsyn.com/295001/rsspodcastindex.org
Wild + (finally fcking) Free: Real, Raw Stories of the Disruptors, Rebels + RevolutionariesKylie Patchett200October 8, 2026Weeklykpkreative.com.auhttps://rss.buzzsprout.com/2060033.rsspodcastindex.org
Migraine HeroesDiane Ducarme200October 28, 2026Weeklymigraineheroes.comhttps://feeds.captivate.fm/migraine-heroes-chron/podcastindex.org
Integrate Yourself | Discover Yourself & Reclaim Your HealthAllison Pelot199October 4, 2026Monthlypureenergypdx.comhttps://rss.buzzsprout.com/866314.rsspodcastindex.org
LightSong School of 21st-Century Shamanism and Energy Medicine Talking Stick PodcastLightSong199October 27, 2026Monthlylightsong.libsyn.com/podcasthttps://lightsong.libsyn.com/rsspodcastindex.org
Live Purely with ElizabethElizabeth Stein199September 9, 2026Every two weekspurelyelizabeth.com/pages/live-purely-podcasthttps://feeds.simplecast.com/r7PBX_wMpodcastindex.org
Health Optimization Medicine PodcastHealth Optimization Medicine and Practice199October 28, 2026Weeklysites.libsyn.com/454677https://feeds.libsyn.com/454677/rsspodcastindex.org
The Neuro Collective PodcastDr. Michael Bagnell & May Bagnell199October 31, 2026Weeklytheneurocollectivepodcast.buzzsprout.comhttps://rss.buzzsprout.com/2381832.rsspodcastindex.org
UnveiledAngela Christian198October 27, 2026Every two weeksangelamariechristian.comhttps://rss.buzzsprout.com/1898833.rsspodcastindex.org
Tap with Brad - Sight UnseenBrad Yates198October 26, 2026Weeklytapwithbrad.com/podcasts/tap-with-brad-sight-unseenhttps://app.kajabi.com/podcasts/2147504534/feedpodcastindex.org
Grow a Thriving PracticeJillian Faldmo198October 29, 2026Every two weeksjillianfaldmo.com/podcasts/grow-a-thriving-practice-2https://app.kajabi.com/podcasts/2147508004/feedpodcastindex.org
Mind Body Medicine for Self HealersSarah Dawkins - Root Cause Healing, Adaptations & Natural Holistic Health Coach198October 29, 2026Weeklysarahdawkins.comhttps://anchor.fm/s/c8b57ee4/podcast/rsspodcastindex.org
The Last American VagabondThe Last American Vagabond198October 30, 2026Weeklytlavagabond.substack.com/podcastpodcastindex.org
Natural Eye Care with Dr. Marc Grossman, Holistic OptometristDr. Marc R Grossman, OD, L.Ac.197October 29, 2026Every two weeksnaturaleyecare.comhttps://rss.buzzsprout.com/1014526.rsspodcastindex.org
Addictive Eaters AnonymousAEA197September 21, 2026Every two weeksaddictiveeatersanonymous.orghttps://rss.buzzsprout.com/680693.rsspodcastindex.org
Root Cause RadioRoot Cause Radio197September 13, 2026Monthlyupliftfitnutrition.comhttps://anchor.fm/s/47f9fb90/podcast/rsspodcastindex.org
Rocket Chiropractic PodcastDr. Jerry Kennedy197October 21, 2026Every two weeksrocketchiro.com/chiropractic-podcasthttps://chiropracticpodcast.libsyn.com/rsspodcastindex.org
Fertility In Focus PodcastDr. Christina Burns197October 8, 2026Every two weeksbuzzsprout.com/1742655https://rss.buzzsprout.com/1742655.rsspodcastindex.org
The Ex-Good Girl PodcastSara Bybee Fisk197October 28, 2026Weeklysarafisk.coachhttps://feeds.captivate.fm/the-ex-good-girl-podcast/podcastindex.org
Just Think: The PodcastJust Think: The Podcast195October 30, 2026Every two weeksrss.com/podcasts/justthinkthepodcasthttps://media.rss.com/justthinkthepodcast/feed.xmlpodcastindex.org
The Dr. Geo Prostate PodcastDr. Geo Espinosa195October 26, 2026Every two weeksdrgeo.comhttps://feeds.captivate.fm/dr-geo-prostate-podcast/podcastindex.org
The Power CoupleBohdanna Diduch & Roman Shapoval195October 30, 2026Weeklyromanshapoval.substack.com/podcastpodcastindex.org
Start Living Sustainable | Healthy Home Reset for MomsCynthia Harvey-Brown | Wellness Coach & Healthy Home Lifestyle Strategist195October 27, 2026Weeklystartlivingsustainable.comhttps://feed.podbean.com/startlivingsustainable/feed.xmlpodcastindex.org
Start Living Sustainable | Healthy Home Reset for MomsCynthia Harvey-Brown | Wellness Coach & Healthy Home Lifestyle Strategist195October 27, 2026Weeklystartlivingsustainable.comhttps://startlivingsustainable.podbean.com/feed.xmlpodcastindex.org
The SpiritualistRebecca Meisl194October 25, 2026Every two weeksrebeccameisl.comhttps://rss.buzzsprout.com/1233209.rsspodcastindex.org
for the healthy hoes.Ri + Slim194October 20, 2026Every two weeksforthehealthyhoes.comhttps://anchor.fm/s/6e56a054/podcast/rsspodcastindex.org
Heal Here: A Podcast for Lightworkers, Healers, & Spiritual SeekersKate Flick194October 30, 2026Weeklyhealhere.podbean.comhttps://feed.podbean.com/healhere/feed.xmlpodcastindex.org
Heal Here: A Podcast for Lightworkers, Healers, & Spiritual SeekersKate Flick194October 30, 2026Weeklyhealhere.podbean.comhttps://healhere.podbean.com/feed.xmlpodcastindex.org
Rejuvenate Podcast with Elwin RobinsonElwin Robinson193October 27, 2026Weeklyrejuvenatepodcast.buzzsprout.comhttps://rss.buzzsprout.com/2077944.rsspodcastindex.org
Awaken Your Inner Wisdom with Cissi WilliamsCissi Williams192October 26, 2026Every two weekscissiwilliams.comhttps://rss.buzzsprout.com/277595.rsspodcastindex.org
Cancer Freedom PodcastDr. Amy Morris192October 28, 2026Weeklysites.libsyn.com/435720https://feeds.libsyn.com/435720/rsspodcastindex.org
Healthy Living with Yoga Anita | inspiring wellness body, mind, soulYoga Anita191October 26, 2026Every two weekspodomatic.com/podcasts/hlthwizhttps://hlthwiz.podomatic.com/rss2.xmlpodcastindex.org
What's the Root Cause? by Dr Vikki PetersenRoot Cause Medical Clinic191October 9, 2026Every two weeksrootcausemedicalclinics.comhttps://rss.buzzsprout.com/226881.rsspodcastindex.org
Women's Health, Wisdom, and. . . WINE!Dr. Laurena White191September 30, 2026Every two weekslaurenawhite.comhttps://rss.buzzsprout.com/1750573.rsspodcastindex.org
Dogs Are IndividualsRita Hogan191October 28, 2026Every two weekscanineherbalism.com/podcasts/dogs-are-individualshttps://app.kajabi.com/podcasts/2147496171/feedpodcastindex.org
Soul & Spirit Connection PodcastLaurie Williams191October 28, 2026Weeklysites.libsyn.com/455685https://feeds.libsyn.com/455685/rsspodcastindex.org
Defiant Health Radio with Dr. William DavisWilliam Davis, MD190October 27, 2026Every two weeksdrdavisinfinitehealth.comhttps://rss.buzzsprout.com/1795054.rsspodcastindex.org
Ram & Goat AstrologyHelena Laura Lee190September 26, 2026Weeklybuzzsprout.com/2050495https://rss.buzzsprout.com/2050495.rsspodcastindex.org
The Dr. Lodi PodcastDr. Thomas Lodi190October 23, 2026Weeklydrlodi.comhttps://rss.buzzsprout.com/2062187.rsspodcastindex.org
Stronger Bones Lifestyle Osteoporosis, Osteopenia & Bone Health PodcastDebi Robinson190October 29, 2026Weeklydebirobinson.comhttps://rss.buzzsprout.com/2046852.rsspodcastindex.org
The Rejuvenating Health PodcastRejuvenating Health190October 29, 2026Weeklyrejuvenatinghealth.nethttps://rss.buzzsprout.com/2267374.rsspodcastindex.org
The Ultimate Birth Partner PodcastSallyann Beresford189October 25, 2026Every two weekssallyannberesford.co.ukhttps://rss.buzzsprout.com/1495228.rsspodcastindex.org
Autoimmune Rehab: Real Stories of Resilience and Healing: How I Healed My Autoimmune Disorder and You Can TooAnnaLaura Brown189October 26, 2026Every two weeksautoimmunerehab.comhttps://feeds.libsyn.com/431427/rsspodcastindex.org
Hope, Healing & Transformation with Lisa WilliamsLisa Williams189September 8, 2026Several times a weeklisawilliams.comhttps://api.riverside.fm/hosting/L0KDlzne.rsspodcastindex.org
The Mentor SessionsFrancesca Cervero188October 27, 2026Monthlyfrancescacervero.com/category/podcasthttps://francescacervero.libsyn.com/rsspodcastindex.org
The Health Upgrade PodcastNavaz Habib188October 28, 2026Every two weekshealthupgraded.comhttps://feeds.transistor.fm/health-upgrade-podcastpodcastindex.org
Did We Just Say That?Kylah Smook & Abi Fernandini188October 30, 2026Every two weeksbuzzsprout.com/2003897https://rss.buzzsprout.com/2003897.rsspodcastindex.org
Healthy As A MotherDr. Morgan MacDermott & Dr. Leah Gordon188October 28, 2026Weeklycohostpodcasting.comhttps://feeds.cohostpodcasting.com/MQNyj2Aapodcastindex.org
A Functional Approach with Dr. Jim ChialtasJim Chialtas, DACM, L.Ac.188October 26, 2026Weeklyfunctionalmedicine-sandiego.comhttps://anchor.fm/s/e1ef4584/podcast/rsspodcastindex.org
Posture ProsDr Daniel Timmerman187October 22, 2026Every two weekslindenwoodschiropractic.comhttps://thehealthycommute.libsyn.com/rsspodcastindex.org
The Energy Balance PodcastJay Feldman Wellness187October 29, 2026Every two weeksenergybalance.podbean.comhttps://energybalance.podbean.com/feed.xmlpodcastindex.org
Dr. Danielle DifferenceDanielle Hofer187October 29, 2026Every two weekscryinginmycheesecake.com/podcasthttps://feeds.captivate.fm/drdanielledifference/podcastindex.org
PT Snacks Podcast: Physical Therapy with Dr. Kasey HankinsKasey Hankins, PT, DPT, OCS187October 20, 2026Every two weeksptsnackspodcast.comhttps://rss.buzzsprout.com/1131395.rsspodcastindex.org
Building Lifelong AthletesJordan Rennicke, MD187October 27, 2026Weeklyjrennickemd.com/podcasts/building-lifelong-athleteshttps://app.kajabi.com/podcasts/2147797730/feedpodcastindex.org
Indigenous Wisdom with Julia CarmenJulia Carmen187October 28, 2026Weeklytheschoolwithoutwalls.net/indigenous-wisdom-podcasthttps://feeds.transistor.fm/indigenous-wisdom-with-julia-carmenpodcastindex.org
Mindful Manifesting - Personal and Spiritual Growth Tips for EntrepreneursAryana K Rollins186October 29, 2026Every two weekshighertrueself.comhttps://feed.pod.co/themanifestingguidepodcastindex.org
XPAND CAPACITY™Dr. Christine Manukyan186October 27, 2026Every two weeksstorrie.libsyn.com/websitehttps://storrie.libsyn.com/rsspodcastindex.org
Healthy AFThe MESH186October 27, 2026Every two weekshealthyafthemesh.podbean.comhttps://feed.podbean.com/healthyafthemesh/feed.xmlpodcastindex.org
Balm To The SoulNatasha Joy Price and Guests186October 31, 2026Every two weeksbuzzsprout.com/1827829https://rss.buzzsprout.com/1827829.rsspodcastindex.org
The Real Health PodcastReal Health Co186October 30, 2026Every two weekstherealhealthpodcast.transistor.fmhttps://feeds.transistor.fm/the-real-health-podcastpodcastindex.org
Confessions of a Male GynecologistShawn Tassone MD PhD186October 29, 2026Every two weekstassonemd.comhttps://feeds.libsyn.com/406622/rsspodcastindex.org
Holistic Marketing SimplifiedMolly Cahill186October 27, 2026Weeklymollycahill.comhttps://podcasts.helloaudio.fm/podcast/1444f1bf-d2dd-4399-93ac-822d4fbd3d06/6fCeZmnM6xpodcastindex.org
Cups Of ConsciousnessAleya Dao186October 26, 2026Weeklybuzzsprout.com/2139076https://rss.buzzsprout.com/2139076.rsspodcastindex.org
Suburban WarriorCrissy Pyfer185October 20, 2026Every two weekssuburbanwarriorpodcast.comhttps://rss.buzzsprout.com/753779.rsspodcastindex.org
Be Well with Dr. Michelle GreenwellDr. Michelle Greenwell185October 7, 2026Every two weeksbewellwithmichellegreenwell.buzzsprout.comhttps://rss.buzzsprout.com/1392208.rsspodcastindex.org
R&R with Ri | Guided Meditations for Anxiety, Stress and SleepRi (Rebecca)185October 25, 2026Weeklywellnesswithri.com/guided-meditation-podcasthttps://rss.buzzsprout.com/2128913.rsspodcastindex.org
Ending Body Burnout ShowChris & Filipa Bellette185October 26, 2026Weeklychrisandfilly.fm/podcasts/ending-body-burnout-showhttps://app.kajabi.com/podcasts/2147506185/feedpodcastindex.org
The Positive Future For Health PodcastAlthea Finch185October 29, 2026Several times a weekpositive-future-for-health.captivate.fmhttps://feeds.captivate.fm/positive-future-for-health/podcastindex.org
Binaural Beats & Rain SoundsNatural Podcasts185August 27, 2026Dailynaturalpodcasts.comhttps://feeds.megaphone.fm/binaural-beats-and-rain-soundspodcastindex.org
One for the Road: The Quit Drinking PodcastDavid Wilson184October 30, 2026Every two weekssoberdave.co.ukpodcastindex.org
The Soul Connection PodcastKatie Arnold184October 26, 2026Every two weeksiamkatiearnold.comhttps://anchor.fm/s/76f47b28/podcast/rsspodcastindex.org
Jen and Dan's Natural Healing with PlantsJen and Dan184October 31, 2026Weeklyjenanddansnaturalhealing.buzzsprout.comhttps://rss.buzzsprout.com/2086281.rsspodcastindex.org
Reclamation Radio with Kelly Brogan MDKelly Brogan MD184October 27, 2026Weeklykellybroganmd.com/podcasthttps://feeds.transistor.fm/reclamation-radio-with-kelly-brogan-mdpodcastindex.org
Hypothetically IntentionalMichelle Aalbers184October 25, 2026Weeklychooseyourself.comhttps://rss.buzzsprout.com/2174822.rsspodcastindex.org
Weight Loss Forensics: FBI Tactics to Investigate Cravings, Overeating, and Why Diets SuckHolly Bertone, PMP, CNHP, and Emotional Eating and Weight Loss Coach184October 30, 2026Weeklypinkfortitude.mykajabi.com/bloghttps://rss.buzzsprout.com/2246922.rsspodcastindex.org
Thriving in MidlifeKellie Lupsha184October 13, 2026Weeklykellielupsha.comhttps://feeds.captivate.fm/thriving-in-midlife/podcastindex.org
Why You Got Sick: How Emotion Drives Chronic Illness & Healing in WomenTecla Di Francesco - Chronic Illness Coach + Mind-Body Practitioner (Certified)183October 27, 2026Every two weeksredcircle.com/shows/why-you-got-sickhttps://feeds.redcircle.com/e68439cf-e6d2-44f5-8aba-7a377f1cb1b9podcastindex.org
9 to 5 WellnessAesha Tahir183October 30, 2026Weekly9to5wellness.comhttps://rss.buzzsprout.com/2299802.rsspodcastindex.org
The Thinking PractitionerTil Luchau & Whitney Lowe182October 28, 2026Every two weeksthethinkingpractitioner.comhttps://www.thethinkingpractitioner.com/feed.xmlpodcastindex.org
The Art of Medicine with Dr. Andrew WilnerAndrew Wilner, MD182October 25, 2026Every two weeksandrewwilner.comhttps://rss.buzzsprout.com/945151.rsspodcastindex.org
The Price for ParadiseWalker Ramsey & Kreston Woods182October 14, 2026Every two weeksthe-price-for-paradise.simplecast.comhttps://feeds.simplecast.com/MV_3uzgwpodcastindex.org
The Constance Messmer PodcastConstance Messmer182October 29, 2026Every two weeksconstancemessmer.comhttps://feeds.captivate.fm/the-constance-messmer-podcast/podcastindex.org
Joette Calabrese PodcastJoette Calabrese: Author, Lecturer and Consultant.181October 22, 2026Monthlyjoettecalabrese.compodcastindex.org
Triple Gem of the NorthTriplegem181October 30, 2026Monthlytriplegem.orghttps://feeds.simplecast.com/t0FmXBPNpodcastindex.org
The Perfect Stool Understanding and Healing the Gut MicrobiomeLindsey Parsons181October 27, 2026Monthlyhighdeserthealthcoaching.com/the-perfect-stoolhttps://theperfectstool.libsyn.com/rsspodcastindex.org
The Quantum Health ConnectionHeather & Vanessa181October 27, 2026Weeklyquantumhealthconnection.buzzsprout.comhttps://rss.buzzsprout.com/2179449.rsspodcastindex.org
The Dylan Gemelli PodcastDylan Gemelli181October 22, 2026Weeklydylangemelli.podbean.comhttps://feed.podbean.com/dylangemelli/feed.xmlpodcastindex.org
✧ ALTAR OF STARS ✧ with Teagan West✧ ALTAR OF STARS ✧ with Teagan West181October 31, 2026Weeklyaltarofstars.substack.com/podcastpodcastindex.org
Know Better | Do BetterAutumn McLees180October 28, 2026Every two weekssites.libsyn.com/432828https://feeds.libsyn.com/432828/rsspodcastindex.org
The Integrative Health Podcast with Dr. JenDr. Jen180October 27, 2026Every two weekspflegmed.comhttps://rss.buzzsprout.com/1504159.rsspodcastindex.org
The Art of Healing PodcastCharlyce Davis MD Functional Medicine and Reiki Healer179September 30, 2026Every two weekshealingartshealthandwellness.comhttps://rss.buzzsprout.com/1287308.rsspodcastindex.org
Daughters of Narcissistic Mothers | Mother Wound Healing After Maternal Narcissism & Family DysfunctionMatilde Crocini | Mother Wound & Inner Transformation Coach179October 27, 2026Every two weekswomenreclaimingtheirfullness.mehttps://audioboom.com/channels/5047612.rsspodcastindex.org
The DUTCH PodcastDUTCH Test179October 27, 2026Every two weeksdutchtest.com/podcasthttps://rss.buzzsprout.com/1968208.rsspodcastindex.org
The Coherence Code PodcastLorne Brown179October 26, 2026Every two weeksyoutube.com/@TheCoherenceCodePodcasthttps://feeds.captivate.fm/consciousfertility/podcastindex.org
The Hardy BrainDr. David Hardy179October 27, 2026Every two weeksthehardybrain.ca/podcasts/the-hardy-brainhttps://app.kajabi.com/podcasts/2147498479/feedpodcastindex.org
Family Reddit TalesFamily Reddit Tales179October 31, 2026Dailyspreaker.com/podcast/family-reddit-tales--6972105https://www.spreaker.com/show/6972105/episodes/feedpodcastindex.org
Clear Acne Naturally - Detoxing with DaniDanielle Ferguson178October 7, 2026Monthlydetoxingwithdani.comhttps://detoxingwithdani.libsyn.com/rsspodcastindex.org
To Health With That! MTHFR Mutations and Methylation.Dr. Amy Neuzil178October 25, 2026Every two weekstohealthwiththat.comhttps://anchor.fm/s/23112ca4/podcast/rsspodcastindex.org
Homeopathy At Home with MelissaMelissa Crenshaw, CBHom, LCHE, RsHom (Na)178October 26, 2026Every two weeksmelissacrenshaw.comhttps://rss.buzzsprout.com/1159652.rsspodcastindex.org
Cornerstone Integrative Healing PodcastCornerstone Integrative Healing178October 26, 2026Weeklysites.libsyn.com/460458https://feeds.libsyn.com/460458/rsspodcastindex.org
The Healing ArtistFreda Maletsky178October 26, 2026Weeklyfredahealing.comhttps://anchor.fm/s/1010f35b4/podcast/rsspodcastindex.org
Rebellious Wellness LifestyleGregory Anne Cox178October 1, 2026Every two weeksrebellious-wellness-lif.captivate.fmhttps://feeds.captivate.fm/rebellious-wellness-lif/podcastindex.org
Ocean Sounds & Tibetan Singing BowlsPodily178October 26, 2026Dailypodily.comhttps://feeds.megaphone.fm/ocean-sounds-tibetan-singing-bowlspodcastindex.org
The Queer SpiritNick Venegoni177October 13, 2026Monthlythequeerspirit.comhttps://thequeerspirit.libsyn.com/rsspodcastindex.org
Weight Loss SolutionsDr. Stephen Cabral177October 21, 2026Every two weekssites.libsyn.com/409421https://feeds.libsyn.com/409421/rsspodcastindex.org
The Queer SpiritNick Venegoni177October 13, 2026Monthlythequeerspirit.comhttps://rss.libsyn.com/shows/123391/destinations/728499.xmlpodcastindex.org
The Herbalist's PathMel Mutterspaugh176August 13, 2026Every two weekstheherbalistspath.comhttps://rss.buzzsprout.com/840427.rsspodcastindex.org
But, What If You Did?®Alyson Haines176August 20, 2026Every two weeksalysonhaineswellness.com/podcasthttps://rss.buzzsprout.com/1800008.rsspodcastindex.org
The Nourished Nervous SystemKristen Timchak176October 29, 2026Weeklynourishednervoussystem.comhttps://rss.buzzsprout.com/2204728.rsspodcastindex.org
The Dr. Ashley ShowDr. Ashley Lucas176October 29, 2026Weeklymyphdweightloss.comhttps://anchor.fm/s/e1cc2108/podcast/rsspodcastindex.org
Deep Sleep Ocean Waves SoundsJosh Linsk176October 31, 2026Several times a weekdeepsleeppodcasts.comhttps://feeds.megaphone.fm/deep-sleep-ocean-waves-soundspodcastindex.org
Conversations with Dr. Cowan & FriendsDr. Tom Cowan176October 28, 2026Every two weeksconversationswithdrcowanandfriends.buzzsprout.comhttps://rss.buzzsprout.com/1280480.rsspodcastindex.org
The Integrative VeterinarianCollege of Integrative Veterinary Therapies175October 31, 2026Every two weeksthe-integrative-veterin.captivate.fmhttps://feeds.captivate.fm/the-integrative-veterin/podcastindex.org
Fit Rx Health + WellnessDr Greg Dennis175October 11, 2026Every two weeksfitrxwellnessok.com/fitrx-health-and-wellness-podcasthttps://rss.buzzsprout.com/1300429.rsspodcastindex.org
True Health RecoveryDr Hugh Wegwerth DC175October 2, 2026Every two weeksdrhughwegwerth.comhttps://rss.buzzsprout.com/1648033.rsspodcastindex.org
A Bit Of A BoostGeorge Anderson175October 26, 2026Every two weeksabitofaboost.libsyn.com/websitehttps://abitofaboost.libsyn.com/rsspodcastindex.org
The Health Bridge Podcast with Holly B.Holly Beck175October 15, 2026Every two weekssites.libsyn.com/434673https://feeds.libsyn.com/434673/rsspodcastindex.org
Beyond Chronic DiseaseWendy Gathercole175October 25, 2026Every two weekswendygathercole.comhttps://anchor.fm/s/7f8a1e14/podcast/rsspodcastindex.org
THE VIBE SCIENCE PODCASTThe Radcast Network175October 28, 2026Weeklyart19.com/shows/the-vibe-science-podcasthttps://rss2.flightcast.com/rrk9wfczanrthadt3g1jsif8.xmlpodcastindex.org
The Wellness Architect PodcastAnna Finck175October 22, 2026Weeklyannafinck.comhttps://anchor.fm/s/98bbe5d4/podcast/rsspodcastindex.org
The Naturist Living ShowBare Oaks Family Naturist Park174August 21, 2026Monthlynaturistlivingshow.comhttps://www.naturistlivingshow.com/feed/podcastpodcastindex.org
Feminine AlchemyThe Feminine Alchemy Podcast Team174October 19, 2026Every two weeksfemininealchemypodcast.comhttps://api.riverside.fm/hosting/M7XPnOXJ.rsspodcastindex.org
The Tara Thorne Wellness PodcastTara Thorne174October 20, 2026Every two weekstarathornenutrition.comhttps://feeds.libsyn.com/425186/rsspodcastindex.org
Life By Mazak Metaphysical PODCASTRobert Mazak174September 29, 2026Every two weeksmazakets.comhttps://anchor.fm/s/80b06fc8/podcast/rsspodcastindex.org
The Vibrant Wellness PodcastVibrant Wellness174September 23, 2026Weeklyvibrantwellnesspodcast.buzzsprout.comhttps://rss.buzzsprout.com/2139049.rsspodcastindex.org
Ignite Your Power: The Kathy Mou PodcastKathy Mou174October 30, 2026Weeklykathymou.com/podcasts/ignite-your-power-the-kathy-mou-podcasthttps://feeds.simplecast.com/yr6vf_qtpodcastindex.org
Mom & Doc Talk: Healing PANS/PANDAS[email protected] (Resilience Naturopathic)174October 27, 2026Weeklyresiliencenaturopathic.comhttps://feeds.castos.com/x419vpodcastindex.org
The Peptide EffectPeptides Made Simple174October 30, 2026Several times a weekthepeptideeffect.comhttps://media.rss.com/the-peptide-effect/feed.xmlpodcastindex.org
Your Health Reclaimed: Exposing The Root Causes Of Lyme & Chronic Illness So You Can Finally HealDr Brad Montagne173October 29, 2026Several times a weekhealthfullyu.comhttps://feeds.captivate.fm/your-health-reclaimed/podcastindex.org
What The Func?!Laura and Clayton172October 22, 2026Every two weeksfunctionalmedicinecoaching.orghttps://functionalmedicinecoaching.libsyn.com/rsspodcastindex.org
Keeping Her Keys: At The Crossroads of Modern Life and the Deeper WorldCyndi Brannen172October 18, 2026Every two weekscyndibrannen.com/podcastpodcastindex.org
The Neijiaquan Podcast - An Internal Martial Arts PodcastIsaac Kamins & Jess O’Brien172October 24, 2026Every two weeksneijiaquan.podbean.comhttps://feed.podbean.com/neijiaquan/feed.xmlpodcastindex.org
Open-Minded HealingMarla Miller172September 29, 2026Every two weekspodcast.openmindedhealing.comhttps://rss.buzzsprout.com/1799937.rsspodcastindex.org
Feel Freaking Amazing™Drs. Wendie Trubow & Edward Levitan | Detox Functional Medicine Toxins and Longevity172October 12, 2026Every two weeksfivejourneys.com/podcasthttps://fivejourneys.libsyn.com/rsspodcastindex.org
The Salarah Kacey Starre PodcastSalarah Kacey Starre172October 26, 2026Every two weekssalarahstarre.comhttps://feeds.captivate.fm/salarah-k-starre/podcastindex.org
IBS Nutrition, Digestion & Gut Health: Inside Knowledge for people with IBSAnna Mapson IBS nutritionist172October 27, 2026Weeklygoodnessme-nutrition.com/inside-knowledge-for-ibshttps://feeds.captivate.fm/inside-knowledge/podcastindex.org
ReInspiring YouJared Williams172October 28, 2026Weeklyrevitalizingyou.square.sitepodcastindex.org
Your Journey to FertilityJennifer Edmonds172October 26, 2026Weeklyelementpilatesyoga.comhttps://rss.buzzsprout.com/2246483.rsspodcastindex.org
Easier Movement, Happier LifeMary Debono171September 22, 2026Every two weeksmarydebono.comhttps://rss.buzzsprout.com/1600387.rsspodcastindex.org
Keep It ClearKatie Stewart, RHN & Cris Brown, RHN171October 7, 2026Weeklykatiestewartwellness.comhttps://feeds.transistor.fm/keep-it-clearpodcastindex.org
Herb Mentor RadioLearningHerbs.com170October 28, 2026Monthlylearningherbs.com/podcasts/herb-mentor-radiohttps://app.kajabi.com/podcasts/2147744347/feedpodcastindex.org
This is Yoga TherapyMichele Lawrence170October 26, 2026Monthlyinnerpeaceyogatherapy.comhttps://rss.buzzsprout.com/349391.rsspodcastindex.org
Running Man Self Regulation Skills ProjectArmando Dominguez PhD Health Psychology, Educator, Martial Artist, Researcher170October 25, 2026Weeklybuzzsprout.com/2216464https://rss.buzzsprout.com/2216464.rsspodcastindex.org
I'm Hormonal | Hormone balance, gut health & nutrition insightsBridget Walton, Women's Hormone Coach170August 24, 2026Weeklyimhormonal.buzzsprout.comhttps://rss.buzzsprout.com/2244665.rsspodcastindex.org
Patricia Lemer: The Autism DetectivePatricia Lemer170October 15, 2026Every two weekspodcasters.spotify.com/pod/show/patricia-lemer4https://anchor.fm/s/94f949b4/podcast/rsspodcastindex.org
Dry Lips & Lip Care | AJ’s EO Infusions® with Jenice Story, RN, BSNJenice Story170October 28, 2026Weeklyajseoinfusions.comhttps://anchor.fm/s/fa1f1c10/podcast/rsspodcastindex.org
Ashtanga TechMichael Joel Hall170October 31, 2026Several times a weekashtanga.techhttps://pub-477a42ee397942aa87e96485ef790f2c.r2.dev/podcast/ashtanga-tech/feed.rsspodcastindex.org
Divine Lotus Healing Show with Laura WestLaura West169October 5, 2026Monthlydivinelotushealing.podbean.comhttps://feed.podbean.com/divinelotushealing/feed.xmlpodcastindex.org
Born to Heal: Holistic Healing for Optimal HealthDr. Katie Deming, M.D. | Conscious Oncologist169October 27, 2026Every two weekskatiedeming.com/borntohealpodcasthttps://rss.buzzsprout.com/1857254.rsspodcastindex.org
Surrendered Birth Stories: Your Christian Birth Story PodcastKayla Heeter169October 26, 2026Weeklysurrenderedbirthservices.com/podcasthttps://rss.buzzsprout.com/2200969.rsspodcastindex.org
Sleep Easy to the Comforting Voice PodcastShasta Re169October 31, 2026Several times a weeksleepeasytothecomfortingvoicepodcast.buzzsprout.comhttps://rss.buzzsprout.com/2463106.rsspodcastindex.org
Keys® Natural Skin SolutionsBob Root169October 16, 2026Several times a weekkeys.buzzsprout.comhttps://rss.buzzsprout.com/2567030.rsspodcastindex.org
Healthy Living Simple with Dr Lisa ODr Lisa Olszewski169October 30, 2026Every two weekshealthylivingsimple.comhttps://feeds.captivate.fm/healthylivingsimple/podcastindex.org
Innergy HealingSonia168October 16, 2026Every two weeksinnergyhealingarts.comhttps://rss.buzzsprout.com/889255.rsspodcastindex.org
Cycle Wisdom: Women's Health & FertilityDr. Monica Minjeur168October 28, 2026Weeklyradiantclinic.comhttps://rss.buzzsprout.com/2220517.rsspodcastindex.org
In Sixteen Years of Endometriosis167October 20, 2026Monthlyinsixteenyears.com/episode-archiveshttps://insixteenyears.com/feed/podcast/podcastindex.org
Default to YES! Your Extraordinary SelfJuli Reynolds, Nurse Coach167September 21, 2026Weeklyreimaginewellness.org/yeshttps://rss.buzzsprout.com/2170406.rsspodcastindex.org
Let's Get Real - A Talk Show for GuysMichael Sharkey167October 31, 2026Weeklybuzzsprout.com/2367072https://rss.buzzsprout.com/2367072.rsspodcastindex.org
Wellness by Designs - Practitioner PodcastDesigns for Health166October 29, 2026Every two weeksdesignsforhealth.com.auhttps://rss.buzzsprout.com/1798931.rsspodcastindex.org
The Stephanie Zeller PodcastStephanie Zeller166October 9, 2026Every two weekstransform.castos.comhttps://feeds.castos.com/kw290podcastindex.org
STRONG MAMA PODCAST - Health and fitness for a stronger pregnancy, birth and postpartum recoveryNicole Scheitlin166October 26, 2026Every two weeksstrongmamawellnessco.comhttps://anchor.fm/s/e84c22f8/podcast/rsspodcastindex.org
Wishing You Well with Maria PatrickMaria166October 29, 2026Weeklyqigongwithmaria.comhttps://rss.buzzsprout.com/2239735.rsspodcastindex.org
Rooted & WildHenry Hawk166October 31, 2026Several times a weekhenry-hawk.comhttps://rss.buzzsprout.com/2516751.rsspodcastindex.org
The Willetts PodcastMaverick Willett165October 26, 2026Every two weeksfeeds.acast.com/public/shows/the-revenge-body-podcastpodcastindex.org
The Flow Artists Podcast by Garden of YogaRane Bowen164October 4, 2026Monthlypodcast.flowartists.comhttps://podcast.flowartists.com/feeds/podcasts/flow-artists/mp3/rss/podcastindex.org
Healthy Discourse with Dr. Wiggy and Emily SaundersWiggy and Emily Saunders164August 21, 2026Every two weeksraisethemwell.comhttps://anchor.fm/s/4a9e3410/podcast/rsspodcastindex.org
Holistic Human Performance PodcastGena Bradshaw Vitale164October 12, 2026Every two weeksholistichumanperformance.cohttps://anchor.fm/s/d8ace904/podcast/rsspodcastindex.org
Under the CanopyOutdoor Journal Radio Podcast Network164September 28, 2026Weeklybuzzsprout.com/2221923https://rss.buzzsprout.com/2221923.rsspodcastindex.org
Lizzie Ens ShowLizzie Ens164October 27, 2026Weeklylizzie-ens-show.captivate.fmhttps://feeds.captivate.fm/lizzie-ens-show/podcastindex.org
Leap of HealthAlex Balgood163October 25, 2026Every two weeksspreaker.com/podcast/leap-of-health--4914597https://www.spreaker.com/show/4914597/episodes/feedpodcastindex.org
Touchology Wellness ExperienceNjideka N. Olatunde163October 19, 2026Every two weekstouchologywellnessexperience.buzzsprout.comhttps://rss.buzzsprout.com/1971503.rsspodcastindex.org
The Wild Woman Podcast with Becca PloenerBecca Ploener163October 29, 2026Weeklycoaching.wildwomanbecca.com/podcasts/the-wild-woman-podcast-with-becca-ploenerhttps://app.kajabi.com/podcasts/2148076501/feed/podcastindex.org
Lactation Business Coaching with Annie and LeahAnnie Frisbie and Leah Jolly162October 29, 2026Monthlypaperlesslactation.com/podcasthttps://feeds.transistor.fm/lactation-business-coaching-with-annie-and-leahpodcastindex.org
Stress Therapy with Cheri Flake: Meditation & Stress Relief for Real LifeCheri Augustine Flake, LCSW162October 15, 2026Every two weeksthestresstherapist.comhttps://www.spreaker.com/show/5624757/episodes/feedpodcastindex.org
The Akashic Recordings with Annette DallooAnnette Dalloo162October 21, 2026Weeklyinfinitesoullove.comhttps://rss.buzzsprout.com/2175229.rsspodcastindex.org
Elaine Hamilton - Exploring Nonduality, Reiki, Meditation and MindfulnessElaine Hamilton Grundy162October 26, 2026Weeklyreiki-centre.comhttps://media.rss.com/reiki-centre/feed.xmlpodcastindex.org
You're Wrong About ADHDGlobal162October 28, 2026Weeklyyoure-wrong-about-adhd.captivate.fmhttps://feeds.captivate.fm/youre-wrong-about-adhd/podcastindex.org
It's Not JUST Menopause: GLP-1 Support, Fat Loss, & Hormone Solutions for Women in MidlifeCindi Stickle161October 25, 2026Every two weekscindistickle.comhttps://feeds.captivate.fm/its-not-just-menopause/podcastindex.org
רבות הדרכים | מורים תורות ושיטות ששינו את פני התודעהרדיו מהות החיים | EOL Radio161October 22, 2026Every two weeksradio.eol.co.ilhttps://www.omnycontent.com/d/playlist/178d72a7-a889-4132-8008-a5cc014ed109/03c2dec3-be21-42dd-ba7a-b19300e3b431/96250d0b-9bc9-4c22-ac9c-b19300e3b473/podcast.rsspodcastindex.org
I AM HealingStrongHealingStrong161October 30, 2026Every two weekshealingstrong.orghttps://rss.buzzsprout.com/1913363.rsspodcastindex.org
Ojas Oasis with Sasha BershadskySasha Bershadsky161October 27, 2026Every two weeksojasoasis.com/podcasthttps://rss.buzzsprout.com/1933047.rsspodcastindex.org
Essential WellnessEssential Wellness161October 20, 2026Every two weekssites.libsyn.com/420860https://feeds.libsyn.com/420860/rsspodcastindex.org
Reversing Hashimoto's - Heal The ThyroidAnshul Gupta MD161October 29, 2026Every two weeksanshulguptamd.com/podcasthttps://rss.buzzsprout.com/2018176.rsspodcastindex.org
The Heart-Led Business ShowTom Jackobs161October 29, 2026Weeklypodcast.heartledbusiness.showhttps://rss.buzzsprout.com/1793649.rsspodcastindex.org
Meditation & Musing with Kristen BeckerKristen Becker160October 29, 2026Every two weeksthekristenbeckerpodcast.buzzsprout.comhttps://rss.buzzsprout.com/768668.rsspodcastindex.org
Podcasts | Mary DeMuthMary DeMuth160October 31, 2026Dailymarydemuth.comhttps://www.marydemuth.com/category/podcasts/feed/podcastindex.org
The Dr. Haley ShowMichael Haley160October 27, 2026Every two weeksdrhaley.comhttps://feeds.captivate.fm/drhaleyshow/podcastindex.org
Mary DeMuthMary DeMuth160October 31, 2026Dailymarydemuth.comhttps://feeds.feedburner.com/MaryDeMuthpodcastindex.org
The Be Well Now PodcastNick McGurk & Dr. Ron Dummar160October 27, 2026Every two weekschwheber.comhttps://rss.buzzsprout.com/2009764.rsspodcastindex.org
The Income Blueprint: Unfiltered with Maren CrowleyMaren Crowley160October 6, 2026Every two weeksmarencrowley.com/income-blueprint-unfiltered-podcasthttps://rss.buzzsprout.com/2100986.rsspodcastindex.org
V.I.B.E. Living PodcastLynnis Woods-Mullins159October 26, 2026Every two weekslinktr.ee/lynnishttps://rss.buzzsprout.com/2342493.rsspodcastindex.org
Keeping Abreast with Dr. JennDr. Jenn Simmons159October 11, 2026Weeklykeepingabreastwithdrjenn.buzzsprout.comhttps://rss.buzzsprout.com/2184587.rsspodcastindex.org
Healthy Parenting Handbook with Katie KimballKatie Kimball159October 29, 2026Weeklyraisinghealthyfamilies.com/podcasthttps://rss.buzzsprout.com/2288641.rsspodcastindex.org
The Vital Veda Podcast: Ayurveda | Vedic Wisdom | Holistic Health & Natural HealingDylan Smith: Ayurvedic Practitioner, Holistic Health Educator, Conscious Entrepreneur158October 28, 2026Monthlyvitalveda.com.auhttps://rss.buzzsprout.com/1010422.rsspodcastindex.org
Baby Steps Nutrition PodcastArgavan Nilforoush, RDN158October 15, 2026Every two weeksbaby-steps-nutrition-podcast.simplecast.comhttps://feeds.simplecast.com/tpjJ2Kblpodcastindex.org
Free Thinking with MontelMontel Williams158October 27, 2026Every two weeksrevolverpodcasts.comhttps://feeds.simplecast.com/mrENgKGypodcastindex.org
Unreal Results for Physical Therapists and Athletic TrainersAnna Hartman158October 22, 2026Every two weeksunrealresultspod.comhttps://rss.buzzsprout.com/2102402.rsspodcastindex.org
Energy Medicine: Align Your Mind, Body, and Spirit!Dr. Mary Sanders158October 15, 2026Every two weeksdrmarysanders.comhttps://anchor.fm/s/d8c98b7c/podcast/rsspodcastindex.org
Rooted In PresenceCarly Killen158October 29, 2026Weeklycarlykillen.comhttps://rss.buzzsprout.com/2229882.rsspodcastindex.org
Right Up My PodcastGwen Watson and Kate White157October 15, 2026Every two weeksrightupmy.buzzsprout.comhttps://rss.buzzsprout.com/1337593.rsspodcastindex.org
Spirit & Soul Healing PodcastAmy Sikarskie, Energy Therapist, Intuitive, Channeler, Awakening Guide and Author157October 27, 2026Every two weeksamysikarskie.com/spirit-%26-soul-healing-1https://feeds.captivate.fm/spirit-and-soul-healing-podcast/podcastindex.org
The Somatic Coaching Academy PodcastAni Anderson & Brian Trzaskos157October 29, 2026Weeklysomaticcoachingacademy.comhttps://rss.buzzsprout.com/2413204.rsspodcastindex.org
WELLPOWER: Breath, Cold & BiohackingKristin Weitzel156September 24, 2026Every two weekswellpower.life/wellpower-podcasthttps://feeds.captivate.fm/wellpower-breath-cold/podcastindex.org
A Little Bit Healthier | Hormone Balance, Brain Fog, Fatigue, Inflammation, Gut Health, Menopause & Weight Loss Resistance SolutionsDr. Meg Mill| Functional Medicine for Women's Health, Hormones & Gut Healing156October 20, 2026Every two weekssites.libsyn.com/413174https://feeds.libsyn.com/413174/rsspodcastindex.org
The Wellness WomanChantal - Live Lean Health / Cycles Wellness156October 22, 2026Every two weekswellnesswoman.simplecast.comhttps://feeds.simplecast.com/oDrrEN9Rpodcastindex.org
Next Level HealingDr. Tara Perry155October 28, 2026Weeklyconsulttara.comhttps://feeds.transistor.fm/next-level-healingpodcastindex.org
Aligned to Rise PodcastAlyssa Chavez155October 28, 2026Weeklybuzzsprout.com/2232799https://rss.buzzsprout.com/2232799.rsspodcastindex.org
The Dance Physio PodcastErika Mayall155October 27, 2026Weeklybuzzsprout.com/2247444https://rss.buzzsprout.com/2247444.rsspodcastindex.org
All The SameTimothy J. Hayes155October 30, 2026Dailyallthesame.infohttps://feeds.podetize.com/rss/XR78f96VRpodcastindex.org
Functionally AutoimmuneBrandi Muilenburg154September 18, 2026Monthlyfeeds.buzzsprout.com/455935.rsshttps://rss.buzzsprout.com/455935.rsspodcastindex.org
Everyday AlchemyTerri154October 10, 2026Every two weeksmyeverydayalchemy.comhttps://rss.buzzsprout.com/1628863.rsspodcastindex.org
The Plan to Eat PodcastPlan to Eat154October 28, 2026Every two weeksplantoeat.com/podcasthttps://rss.buzzsprout.com/1869657.rsspodcastindex.org
The Radical Obedience® Podcast with Lisa A. Smith. Helping entrepreneurs eliminate chronic stress through complete surrenderLisa A. Smith154October 26, 2026Every two weekstheplantprotocol.podbean.comhttps://feed.podbean.com/ThePlantProtocol/feed.xmlpodcastindex.org
The Radical Obedience® Podcast with Lisa A. Smith. Helping entrepreneurs eliminate chronic stress through complete surrenderLisa A. Smith154October 26, 2026Every two weekstheplantprotocol.podbean.comhttps://theplantprotocol.podbean.com/feed.xmlpodcastindex.org
TheDocNCarolynPodcastDoc N Carolyn154October 29, 2026Weeklythedocncarolynpodcast.comhttps://rss.buzzsprout.com/2261931.rsspodcastindex.org
For the Love of ChiropracticDr. Robert Frieman154October 28, 2026Weeklyfortheloveofchiropracic.comhttps://rss.buzzsprout.com/2279816.rsspodcastindex.org
Unapologetic Living with Elizabeth ElliottElizabeth Elliott154October 19, 2026Weeklyfusionbodyworkandwellness.comhttps://api.riverside.com/hosting/MU35SidR.rsspodcastindex.org
Healing Her Story with Riva Jean-PaulRiva Jean-Paul154October 23, 2026Weeklywindsofchangesac.comhttps://rss.buzzsprout.com/2439925.rsspodcastindex.org
Unapologetic Living with Elizabeth ElliottElizabeth Elliott154October 19, 2026Weeklyfusionbodyworkandwellness.comhttps://rss.buzzsprout.com/2390600.rsspodcastindex.org
Spirits Path PodcastFaern153October 20, 2026Monthlyspiritspathpodcast.buzzsprout.comhttps://rss.buzzsprout.com/691230.rsspodcastindex.org
Parenting UP! Caregiving adventures with comedian J SmilesJ Smiles153October 27, 2026Every two weeksparentingup.buzzsprout.comhttps://rss.buzzsprout.com/1085783.rsspodcastindex.org
The Barbara Thompson PodcastBarbara Thompson153September 1, 2026Every two weeksselfcarebybarbarathompson.com.auhttps://rss.buzzsprout.com/1959509.rsspodcastindex.org
Menopause Rise and Thrive | Helping Women Navigate Midlife and MenopauseDr. Sara Poldmae | Healer, Doctor of Acupuncture and Chinese medicine, and Functional Medicine Practitioner153October 22, 2026Every two weeksrisingwomanproject.comhttps://rss.buzzsprout.com/2170963.rsspodcastindex.org
Awakened Living with NibodhiNibodhi153October 27, 2026Several times a weeknibodhi.com/podcasts/awakened-living-with-nibodhihttps://app.kajabi.com/podcasts/2147965852/feedpodcastindex.org
Kind MindMichael Todd Fink152October 22, 2026Monthlymichaeltoddfink.com/kindmindhttps://michaeltoddfink.squarespace.com/kindmind?format=rsspodcastindex.org
Everyday Ayurveda and Yoga at Hale PuleMyra Lewin at Hale Pule School of Ayurveda and Yoga152October 2, 2026Monthlyhalepule.comhttps://rss.buzzsprout.com/39107.rsspodcastindex.org
The Frontline Herbalism PodcastSolidarity Apothecary152October 11, 2026Every two weekssolidarityapothecary.orghttps://feeds.captivate.fm/frontline-herbalism-podcast/podcastindex.org
Press Pause PodcastKatrina & Lauren152October 26, 2026Weeklybuzzsprout.com/2196053https://rss.buzzsprout.com/2196053.rsspodcastindex.org
The Midlife GraceGinger Monceaux152October 27, 2026Weeklythe-midlife-grace.captivate.fmhttps://feeds.captivate.fm/the-midlife-grace/podcastindex.org
Sleep Time: Sleep Meditations with Nicky SuttonNicky Sutton151October 26, 2026Every two weeksnickysutton.compodcastindex.org
The NatureCity PodcastNature City151October 16, 2026Every two weeksnature-city-podcast.captivate.fmhttps://feeds.captivate.fm/nature-city-podcast/podcastindex.org
SLP Full DisclosureAMN Healthcare150October 27, 2026Monthlyamnhealthcare.com/podcast/slp-full-disclosurehttps://feeds.simplecast.com/0Z0aoA1qpodcastindex.org
Woke Blokes PodcastNick Sutherland & Ryan Hassan150September 27, 2026Monthlymyndfit.com.au/woke-blokes-podcasthttps://cod-cod-7l8a.squarespace.com/woke-blokes-podcast?format=rsspodcastindex.org
LifeSpa: Ayurveda Meets Modern ScienceDr. John Douillard, DC, CAP150September 3, 2026Monthlylifespa.com/podcasthttp://feeds.feedburner.com/lifespa-podcastspodcastindex.org
The Science of Self-HealingThe Bioregulatory Medicine Institute150October 20, 2026Every two weeksthescienceofselfhealing.libsyn.com/sitehttps://thescienceofselfhealing.libsyn.com/rsspodcastindex.org
What The FertilityAmanda Bristow and Catherine Baker150August 31, 2026Every two weekswhatthefertilitypod.comhttps://feeds.blubrry.com/feeds/whatthefertility.xmlpodcastindex.org
Somatic Healing MeditationsKarena Neukirchner150October 30, 2026Weeklybleav.com/shows/somatic-healing-meditationshttps://feeds.simplecast.com/7Lara3EQpodcastindex.org
The MAHA ReportMAHA™ Action150September 11, 2026Weeklythemahareport.comhttps://rss.buzzsprout.com/2567509.rsspodcastindex.org
Magic SeedsLaura R. Gries150October 28, 2026Every two weekslaurakarch11.podbean.comhttps://feed.podbean.com/laurakarch11/feed.xmlpodcastindex.org
One Thing with Dr. Adam RindeDr. Adam Rinde150October 30, 2026Monthlysoundintegrative.comhttps://feeds.captivate.fm/one-thing-with-dr-adam/podcastindex.org
Health Innovation MattersMichael Levin-Epstein149October 9, 2026Monthlyhealthinnovationmatters.libsyn.com/websitehttps://healthinnovationmatters.libsyn.com/rsspodcastindex.org
What Resonates?Andrea Kennedy149September 18, 2026Every two weekswhatresonatespodcast.comhttps://rss.buzzsprout.com/1454596.rsspodcastindex.org
Build Your Reiki BusinessChristian Stone149October 19, 2026Every two weeksstandingstoneshealing.com/podcasthttps://anchor.fm/s/dcdda874/podcast/rsspodcastindex.org
Confidently Balance Your HormonesDee Davidson149October 26, 2026Weeklyconfidentlyloveyourself.squarespace.comhttps://feeds.transistor.fm/confidently-balance-your-hormonespodcastindex.org
The Daring Well Podcast - Holistic Health & Wellness, Mindset, and Personal GrowthRita Mercer, Wellness, Mindset & Mental Health Expert149October 28, 2026Weeklydaringwell.comhttps://rss.buzzsprout.com/2270384.rsspodcastindex.org
Ageless Athlete — Healthy Aging for a Strong, Capable LifeKush Khandelwal149October 28, 2026Weeklyagelessathlete.cohttps://rss.buzzsprout.com/2300423.rsspodcastindex.org
Migraine Freedom: Your wayDebbie Waidl149October 26, 2026Weeklysites.libsyn.com/498553https://feeds.libsyn.com/498553/rsspodcastindex.org
Easy Stress CuresStephen Carter148October 13, 2026Monthlysites.google.com/view/mind-over-stress/homehttps://www.spreaker.com/show/4154713/episodes/feedpodcastindex.org
Corrective CultureCallan Krause148October 22, 2026Every two weekscorrective-culture.simplecast.comhttps://feeds.simplecast.com/6FyKcvMUpodcastindex.org
Unlock Your Vitality with MagalionajourneyMagali Mathieu148October 21, 2026Every two weeksmagalionajourney.com/podcasts/unlock-your-vitality-with-magalionajourneyhttps://app.kajabi.com/podcasts/2147509371/feedpodcastindex.org
AcuPro - The Wonders of Acupuncture & Chinese MedicineClara Cohen148October 28, 2026Weeklyacuproacademy.comhttps://rss.buzzsprout.com/2276216.rsspodcastindex.org
Restorative AudioVibes AI148August 7, 2026Weeklyvibesbiowear.ai/product/restorativeaudiohttps://rss.buzzsprout.com/2200587.rsspodcastindex.org
The Inspired YogiJim (The Yogi)148October 17, 2026Weeklyfacebook.com/profile.phphttps://rss.buzzsprout.com/2367132.rsspodcastindex.org
The Dementia DialoguesNatalie Carter148October 28, 2026Weeklysites.libsyn.com/554062https://feeds.libsyn.com/554062/rsspodcastindex.org
Hope Survives | Brain Injury PodcastCristabelle Braden and Hope Survives148October 28, 2026Every two weekshopesurvives.orghttps://feeds.captivate.fm/hopesurvives/podcastindex.org
Toni UnleashedToni Shelaske147October 14, 2026Every two weekssites.libsyn.com/408143https://feeds.libsyn.com/408143/rsspodcastindex.org
SHOCK & Y’ALLNicole Sciacca147October 27, 2026Weeklyshock-yall.captivate.fmhttps://feeds.captivate.fm/shock-yall/podcastindex.org
Wellness UncensoredTalk 4 Podcasting147October 29, 2026Weeklyspreaker.com/podcast/wellness-uncensored--5937142https://www.spreaker.com/show/5937142/episodes/feedpodcastindex.org
The Many Faces of CancerMelissa Grosboll147October 27, 2026Weeklybuzzsprout.com/2322714https://rss.buzzsprout.com/2322714.rsspodcastindex.org
Honestly UnbalancedAdam Husler146October 14, 2026Monthlyhonestlyunbalanced.comhttps://feeds.captivate.fm/honestly-unbalanced/podcastindex.org
Her Best VersionNaturopath Kasey Willson146October 20, 2026Every two weekskaswywillson.comhttps://rss.libsyn.com/shows/298241/destinations/2356895.xmlpodcastindex.org
Lights Out Library: Sleep DocumentariesOlimpia Pérez146October 25, 2026Weeklypodcasters.spotify.com/pod/show/lights-out-library7https://feeds.megaphone.fm/GSGP3700210220podcastindex.org
The Ordinary Doula PodcastAngie Rosier146October 30, 2026Weeklybirthlearning.comhttps://rss.buzzsprout.com/2267018.rsspodcastindex.org
Roots of the Rise | Authentic Alignment and TransformationSarah Hope | Whole Person Healing, Soul Deep Transformation146September 23, 2026Weeklyrootsoftherise.comhttps://rss.buzzsprout.com/2451696.rsspodcastindex.org
The Technician PodcastTravis Cochran145October 27, 2026Every two weeksbuzzsprout.com/1815205https://rss.buzzsprout.com/1815205.rsspodcastindex.org
Forum Health Integrative Medicine PodcastForum Health145October 27, 2026Every two weeksforumhealth.comhttps://anchor.fm/s/10b000c9c/podcast/rsspodcastindex.org
Healing The Source PodcastClaudia Briare145October 28, 2026Every two weekshealingthesource.cohttps://feeds.libsyn.com/451539/rsspodcastindex.org
feelgooderyKyle Buchanan145October 22, 2026Every two weeksbuzzsprout.com/2142610https://rss.buzzsprout.com/2142610.rsspodcastindex.org
Gettin Real with Cockney BuddhaCockney Buddha145October 30, 2026Weeklymindnutrition4all.comhttps://rss.buzzsprout.com/2286205.rsspodcastindex.org
Beyond DiagnosisRita De Michele145October 15, 2026Weeklybeyonddiagnosis.buzzsprout.comhttps://rss.buzzsprout.com/1792698.rsspodcastindex.org
Everyday Epigenetics: Raw. Real. Relatable.Susan Robbins145October 19, 2026Weeklyeverydayepigenetics.buzzsprout.comhttps://rss.buzzsprout.com/2328546.rsspodcastindex.org
Spiritual Sanctuary: Wisdom for the Divine FeminineBertena, Priestess145October 27, 2026Every two weeksbertena.orghttps://feeds.captivate.fm/spiritual-sanctuary/podcastindex.org
Beyond the PillsJosh Rimany144October 27, 2026Every two weeksbeyond-the-pills.captivate.fmhttps://feeds.captivate.fm/beyond-the-pills/podcastindex.org
Learn to Thrive with ADHD PodcastMande John144October 29, 2026Every two weekslearntothrivewithadhd.comhttps://rss.buzzsprout.com/1954263.rsspodcastindex.org
Soul AwakeningJoy Truscott144August 13, 2026Weeklyjoytruscott.comhttps://rss.buzzsprout.com/2252456.rsspodcastindex.org
Fertility, Pregnancy, & Period Tips: Hormone Health ClassVanda, Fertility & Hormone Nurse + Functional Practitioner144October 27, 2026Weeklyhormonehealthclass.buzzsprout.comhttps://rss.buzzsprout.com/2214197.rsspodcastindex.org
CannaFitness and Nutrition PodcastBeth Skinner Jasinski144October 28, 2026Weeklycannafitnessnutrition.comhttps://anchor.fm/s/ec0b1dcc/podcast/rsspodcastindex.org
PCOS Unfiltered: Nourish, Heal, ThriveLindsie Vizethann144October 30, 2026Weeklypcos-unfiltered-nourish-heal-thrive.simplecast.comhttps://feeds.simplecast.com/PvQuCz0wpodcastindex.org
The NeuFit Undercurrent PodcastGarrett Salpeter143October 23, 2026Monthlyneu.fit/podcasthttps://undercurrent.libsyn.com/rsspodcastindex.org
Musings and Modalities with Tristen Stawicki: Your Pragmatic Shaman BestieTristen Stawicki143October 22, 2026Weeklymusingsandmodalities.comhttps://www.spreaker.com/show/6095167/episodes/feedpodcastindex.org
Soulfull Sound PodcastSimone Niles142October 28, 2026Monthlysimoneniles.com/podcasts/soulfull-sound-podcasthttps://app.kajabi.com/podcasts/2147498165/feedpodcastindex.org
Emily the Mystic ShowEmily Logan Lewis142October 28, 2026Weeklyemilythemystic.com/podcasts/emily-the-mystic-showhttps://app.kajabi.com/podcasts/2147707657/feedpodcastindex.org
The Crystal Bar PodcastClaire Titmus & The Crystal Bar142October 28, 2026Weeklythecrystalbar.podbean.comhttps://feed.podbean.com/thecrystalbar/feed.xmlpodcastindex.org
Awakening AirwavesY Williams142October 30, 2026Weeklyspreaker.com/podcast/awakening-airwaves--6619020https://www.spreaker.com/show/6619020/episodes/feedpodcastindex.org
TAKE A DEEP BREATHMike Maher141October 15, 2026Monthlybuzzsprout.com/1171214https://rss.buzzsprout.com/1171214.rsspodcastindex.org
Sauna TalkSaunaTimes141October 23, 2026Monthlysaunatimes.libsyn.comhttps://saunatimes.libsyn.com/rsspodcastindex.org
The Richard Nicholls Mental Health PodcastRichard Nicholls141October 30, 2026Monthlyrichardnicholls.nethttps://feeds.feedburner.com/richardnichollspodcastindex.org
Infertility FeelingsJesse and Doug from Uniquely Knitted141October 26, 2026Every two weeksinfertilityfeelingspodcast.buzzsprout.comhttps://rss.buzzsprout.com/1357159.rsspodcastindex.org
Higher Self with Carina ShinesCarina Shines141October 28, 2026Every two weeksmatriarchmedicine.shophttps://rss.buzzsprout.com/1593913.rsspodcastindex.org
The Empowered Feminine With Ciara FoyCiara Foy141September 16, 2026Every two weeksciarafoy.comhttps://rss.buzzsprout.com/1359526.rsspodcastindex.org
Spiritual Wealth with Alexandra Savithri, M.A.Alexandra Savithri141October 31, 2026Every two weeksreikiacademy.orghttps://rss.buzzsprout.com/2183559.rsspodcastindex.org
Back into AlignmentJoa Rivas140August 29, 2026Monthlyjoafitness.comhttps://joafitness.libsyn.com/rsspodcastindex.org
Rainbows RisingRainbow Raaja140September 30, 2026Monthlyrainbowraaja.lovehttps://rss.buzzsprout.com/1299739.rsspodcastindex.org
Style and Stewardship | Holistic Health for Christian Women: Inflammation, Blood Sugar, Gut Health & Biblical StewardshipCher Certified Holistic Nutrition Practitioner140October 26, 2026Monthlystyleandstewardship1.podbean.comhttps://feed.podbean.com/styleandstewardship1/feed.xmlpodcastindex.org
IVF Prep at HealthYouniversityDr. Susan Fox140October 25, 2026Every two weekshealthyouniversity.cohttps://rss.buzzsprout.com/2075436.rsspodcastindex.org
Sprinkles Of SpiritLisa Flora140October 20, 2026Every two weekssprinklesofspirit.buzzsprout.comhttps://rss.buzzsprout.com/2103407.rsspodcastindex.org
The Talking Apron with Anne Bernardin: Conversations about Nutrition, Habits and Healthy AgingAnne Bernardin140October 14, 2026Every two weekssites.libsyn.com/474972https://feeds.libsyn.com/474972/rsspodcastindex.org
The Wellness ProcessElizabeth Endres140October 27, 2026Weeklyart19.com/shows/the-wellness-processhttps://rss.art19.com/the-wellness-processpodcastindex.org
Rooted in Wellness with Mona SharmaMona Sharma140October 28, 2026Weeklymonasharma.com/podcasthttps://rss2.flightcast.com/iefa8pe618nydqg68b8ursda.xmlpodcastindex.org
What's the Word?Jaime McFaden139August 14, 2026Every two weeksbuzzsprout.com/663151https://rss.buzzsprout.com/663151.rsspodcastindex.org
Acupuncture Marketing SchoolMichelle Grasek, MS, L.Ac.139October 27, 2026Every two weeksmichellegrasek.com/bloghttps://rss.buzzsprout.com/1615306.rsspodcastindex.org
Believe Big PodcastIvelisse Page139October 20, 2026Every two weeksbelievebigpodcast.buzzsprout.comhttps://rss.buzzsprout.com/1892370.rsspodcastindex.org
Functionally Enlightened - Better ways to heal from chronic pain and illnessFunctionally Enlightened139October 29, 2026Every two weeksfunctionallyenlightened.comhttps://anchor.fm/s/daa3de0c/podcast/rsspodcastindex.org
Pets Who Thrive!Tammy Doak138September 25, 2026Every two weeksbuzzsprout.com/1518400https://rss.buzzsprout.com/1518400.rsspodcastindex.org
Beyond The Fountain Of YouthDr. Julian R. Gerson, Jr.138October 27, 2026Weeklysites.libsyn.com/513058https://feeds.libsyn.com/513058/rsspodcastindex.org
Get Trauma Informed PodcastWellness Coach Liz Blanding138October 6, 2026Weeklyoasiswellnessctrs.comhttps://rss.buzzsprout.com/2321621.rsspodcastindex.org
Conscious Curiosities with Maria Luz PodcastMaria Luz O'Rourke138October 23, 2026Weeklymarialuzorourke.substack.com/podcastpodcastindex.org
Katie The Traveling Lactation ConsultantKatie137October 27, 2026Every two weeksbuzzsprout.com/1784385https://rss.buzzsprout.com/1784385.rsspodcastindex.org
The Happy Healthy Strong PodcastDr. Alex Arguello137October 26, 2026Every two weekspodcasters.spotify.com/pod/show/happyhealthystrongpodcasthttps://anchor.fm/s/6942480c/podcast/rsspodcastindex.org
Strange Rare Peculiar Homeopathy PodcastThe Institute for the Advancement of Homeopathy137October 27, 2026Every two weeksacademyofhomeopathyeducation.comhttps://anchor.fm/s/8c520a30/podcast/rsspodcastindex.org
Holistic Dentistry Show with Dr. SandaSanda Moldovan137October 29, 2026Every two weekssites.libsyn.com/460395https://feeds.libsyn.com/460395/rsspodcastindex.org
Mamun's PodcastMamun137October 31, 2026Several times a weekpalmbeachregenerativeorthopedics.comhttps://rss.buzzsprout.com/2590803.rsspodcastindex.org
Holistic Dentistry Show with Dr. SandaSanda Moldovan137October 29, 2026Every two weekssites.libsyn.com/460395https://rss.libsyn.com/shows/460395/destinations/3882489.xmlpodcastindex.org
Yoga by Nature PodcastMorven Hamilton136October 23, 2026Monthlyyogacommunity.libsyn.com/rsshttps://yogacommunity.libsyn.com/rsspodcastindex.org
RipplesbyJiaJia136October 25, 2026Every two weeksopulencewithjia.comhttps://rss.buzzsprout.com/1961638.rsspodcastindex.org
Healing Our Grieving Hearts PodcastDr. Kay Fontana136October 31, 2026Weeklyhealingourgrievinghearts.comhttps://feeds.captivate.fm/healing-our-grieving-he/podcastindex.org
Yoga by Nature PodcastMorven Hamilton136October 23, 2026Monthlyyogacommunity.libsyn.com/rsshttps://rss.libsyn.com/shows/44745/destinations/144590.xmlpodcastindex.org
So Ready For Health's PodcastSo Ready For Health135October 4, 2026Monthlysoreadyforhealth.comhttps://rss.buzzsprout.com/838417.rsspodcastindex.org
Behavioral Health IntegrationJacob Minnig135September 22, 2026Every two weekspod.co/behavioral-health-integrationhttps://feed.pod.co/behavioral-health-integrationpodcastindex.org
The Petty Herbalist PodcastPetty Herbalist135October 24, 2026Every two weekspettyherbalist.comhttps://anchor.fm/s/42f5040/podcast/rsspodcastindex.org
Holistic Health HeroesKery Knutson135October 25, 2026Every two weeksngvitamins.comhttps://rss.buzzsprout.com/2268995.rsspodcastindex.org
Wholistic LivingMarla Pietruszko135October 20, 2026Every two weeksholisticspring.comhttps://www.spreaker.com/show/5815119/episodes/feedpodcastindex.org
Armor Up with Lorayne MichaelsLorayne134October 23, 2026Every two weeksthebitesizepodcastwithloraynemichaels.buzzsprout.comhttps://rss.buzzsprout.com/2159494.rsspodcastindex.org
Limitless Health - Alternative Solutions for Women 40+Kate McDowell134September 29, 2026Every two weeksalignednaturalhealth.com/limitless-health-podcast-aligned-natural-healthhttps://app.kajabi.com/podcasts/2147512006/feedpodcastindex.org
Thriving in Plain SightBrigitt Thompson134October 14, 2026Weeklybuzzsprout.com/2333374https://rss.buzzsprout.com/2333374.rsspodcastindex.org
Trifecta Collective - Finding the RootMegan Abbott134October 27, 2026Weeklysites.libsyn.com/522933https://rss.libsyn.com/shows/522933/destinations/4492818.xmlpodcastindex.org
The Mycelium MysteriesMark M. Whelan and Ana Gomez de Leon134October 28, 2026Weeklyfuturecenterventures.comhttps://anchor.fm/s/1049f91c4/podcast/rsspodcastindex.org
Disorganized Productions: Chaos Creates HarmonyRob Nolken134October 31, 2026Every two weeksspreaker.com/podcast/disorganized-productions-chaos-creates-harmony--7012172https://www.spreaker.com/show/7012172/episodes/feedpodcastindex.org
The Somatic Strength CollectiveMandy L Ryle134October 20, 2026Monthlyempoweredself.mehttps://rss.buzzsprout.com/1924439.rsspodcastindex.org
The Photovoltaic PodcastE.N.HUB133October 30, 2026Monthlyconellaholdings.comhttps://rss.buzzsprout.com/562342.rsspodcastindex.org
Post Trauma Secrets & DeclutteringValerie Huard and JM Tetreault133October 27, 2026Every two weeksposttraumasecretsdecluttering.buzzsprout.comhttps://rss.buzzsprout.com/1643110.rsspodcastindex.org
Little ByKristin Oja133October 14, 2026Every two weeksdrkristinoja.comhttps://feeds.resonaterecordings.com/little-bypodcastindex.org
Love Your GutDr. Heather Finley133October 30, 2026Every two weeksdrheatherfinley.cohttps://rss.buzzsprout.com/1956352.rsspodcastindex.org
Ahead of the Curve, The Scoliosis ExperienceDr. Meghan Teed, PT, DPT133September 13, 2026Every two weeksthescoliotherapist.com/podcasthttps://rss.buzzsprout.com/2165386.rsspodcastindex.org
Type 2 Diabetes TalkDr Jedha133October 20, 2026Every two weekstype2diabetestalk.comhttps://rss.buzzsprout.com/2267459.rsspodcastindex.org
Integrative Women's Health PodcastJessica Drummond133October 27, 2026Weeklyintegrativewomenshealthinstitute.comhttps://feeds.captivate.fm/integrative-womens-health/podcastindex.org
KISC My Health Radio & Stephen LukawskiPeter Mingils133October 30, 2026Weeklyspreaker.com/podcast/kisc-my-health-radio-stephen-lukawski--6542130https://www.spreaker.com/show/6542130/episodes/feedpodcastindex.org
Staying AgelessStaying Ageless Inc.132October 10, 2026Monthlystayingagelessshow.comhttps://feeds.simplecast.com/I6QOLEp9podcastindex.org
The Modern Sage PodcastLeah Guy132October 8, 2026Every two weeksleahguy.comhttps://rss.buzzsprout.com/1723616.rsspodcastindex.org
Between Two White CoatsOur Family Health Center132October 26, 2026Every two weeksshows.acast.com/between2whitecoatspodcastindex.org
InspireDebbie Romero132October 30, 2026Every two weeksrss.com/podcasts/transcendwithdebbiehttps://media.rss.com/transcendwithdebbie/feed.xmlpodcastindex.org
HOLY WILD BIRTH : Training Christian Birthkeepers, Traditional Midwives in Faith-Based Birth WorkBrooke Collier + Lauren Hall - traditional midwife, birthkeeper, doula coaches132October 28, 2026Every two weekshearthmotherministries.comhttps://anchor.fm/s/a10db44c/podcast/rsspodcastindex.org
Disorganized Productions "Chaos creates Harmony"Rob Nolken132October 31, 2026Every two weeksserve.podhome.fm/disorganized-productionshttps://serve.podhome.fm/rss/860fd437-c3aa-427c-9b40-b2a10a4dfa78podcastindex.org
Faith Over Pharma | Holistic Health, Longevity, Hormones & FertilitySusan Gladstein | Holistic Health & Longevity Practitioner132October 26, 2026Weeklysusangladstein.comhttps://feed.podbean.com/susangladstein/feed.xmlpodcastindex.org
Ketamine ConnectionsAnna Krishtal132October 28, 2026Weeklyyourketaminecoach.com/ketamine-readyhttps://rss.buzzsprout.com/2389031.rsspodcastindex.org
Sun & Moon Sober Living PodcastMary Tilson131October 19, 2026Every two weeksbuzzsprout.com/1901406https://rss.buzzsprout.com/1901406.rsspodcastindex.org
Halfway To Dead, A Midlife AwakeningJen Lovell131October 28, 2026Weeklyhalfwaytodeadpodcast.comhttps://rss.buzzsprout.com/2317284.rsspodcastindex.org
Self-Help LibraryThe Podcast Network131October 31, 2026Weeklyspreaker.com/podcast/self-help-library--6489492https://www.spreaker.com/show/6489492/episodes/feedpodcastindex.org
Deprescribing PharmacistDr Leyla Ali131October 28, 2026Every two weeksdeprescribingpharmacist.orghttps://anchor.fm/s/ffc98844/podcast/rsspodcastindex.org
The Neurologic Wellness PodcastThe Neurologic Wellness Institute130August 26, 2026Monthlyneurologicwellness.libsyn.com/websitehttps://neurologicwellness.libsyn.com/rsspodcastindex.org
The Cancer Pod: Integrative Medicine TalkThe Cancer Pod130October 21, 2026Every two weeksthecancerpod.comhttps://rss.buzzsprout.com/1824572.rsspodcastindex.org
What the HORMONESKate Nguy130October 23, 2026Every two weekssheerevival.comhttps://anchor.fm/s/bbdf93f8/podcast/rsspodcastindex.org
THE OTHER SIDE OF MEDICINE PODCASTDr. James Krystosik130October 30, 2026Every two weekstheothersideofmedicine.comhttps://rss.libsyn.com/shows/445245/destinations/3727728.xmlpodcastindex.org
Perimenopause SimplifiedClaudia Petrilli130October 28, 2026Weeklysites.libsyn.com/508978https://feeds.libsyn.com/508978/rsspodcastindex.org
Healing Heroines: Real Stories of Purpose, Growth, & Transformationchandler stroud130October 28, 2026Weeklyhealingheroespodcast.comhttps://rss.buzzsprout.com/2357301.rsspodcastindex.org
GLP-1 Hub: Support, Community, and Weight LossAna Reisdorf, MS, RD130October 29, 2026Weeklyglp-1hub.comhttps://rss.buzzsprout.com/2455627.rsspodcastindex.org
Clean Your F*cking House B*tchKevin Anderson129September 3, 2026Every two weeksfacebook.com/groups/cyfhbhttps://rss.buzzsprout.com/1785842.rsspodcastindex.org
The Healing Grove PodcastKristin Reihman, MD129October 26, 2026Every two weekslinktr.ee/kristinreihmanmdhttps://rss.buzzsprout.com/2043703.rsspodcastindex.org
Functional Moms PodcastRaquel B. Cartagena and Kristin Brucker129October 27, 2026Every two weeksfunctionalmedicinecoachingmoms.comhttps://anchor.fm/s/df9bd964/podcast/rsspodcastindex.org
The Balanced Body PodcastMonika Eva129October 26, 2026Weeklybuzzsprout.com/2301559https://rss.buzzsprout.com/2301559.rsspodcastindex.org
Biohackers World PodcastBiohackers World129October 26, 2026Weeklypodcast.biohackers.worldhttps://feeds.simplecast.com/xqbknZ2ipodcastindex.org
The Dr Pompa PodcastDr. Daniel Pompa129October 28, 2026Less than monthlyspreaker.com/podcast/the-dr-pompa-podcast--6665673https://rss.buzzsprout.com/2601147.rsspodcastindex.org
CrazyFitnessGuy® | Autistic Wellness & Fitness PodcastJimmy Clare | Autistic Fitness Coach & Podcast Host129October 30, 2026Monthlycrazyfitnessguy.comhttps://feeds.captivate.fm/the-crazyfitnessguy-show/podcastindex.org
Happiness From WithinJanet Prado128October 20, 2026Monthlyhappinessfromwithin.libsyn.com/websitehttps://happinessfromwithin.libsyn.com/rsspodcastindex.org
Be EncouragedJay Close128October 25, 2026Every two weeksjay-close.comhttps://rss.buzzsprout.com/1937014.rsspodcastindex.org
Sleep is My Waking PassionAlison Kole128October 28, 2026Every two weekssleepismywakingpassion.buzzsprout.comhttps://rss.buzzsprout.com/2173002.rsspodcastindex.org
Flip the Script with VicVictoria, @victoriamargauxnielsen128October 20, 2026Every two weeksvictoriamargaux.comhttps://api.riverside.fm/hosting/KOLFK3qp.rsspodcastindex.org
True for YouRenee Cupples128September 11, 2026Every two weekstrueforyou.buzzsprout.comhttps://rss.buzzsprout.com/2247525.rsspodcastindex.org
Pain Free BirthKaren Welton128October 27, 2026Weeklypainfreebirth.comhttps://rss.buzzsprout.com/2507812.rsspodcastindex.org

Next 500 shows

Updated November 3, 2026. Read from Podcast Index. Free for any use (the Podcast Index public database). Episode counts and dates are as each show's feed reports them to the Podcast Index. How often a show publishes is the average gap between its first and its latest episode. The index keeps at most 1,000 episodes of a show. Owner names are printed as the feed prints them. Contact addresses are not shown here. Free to reuse with credit to SpecStream under CC BY 4.0. Spot a wrong value? Write to [email protected] with the link to this page.