# Private fleets in the US: 152,107 with 5+ trucks, page 128

Updated November 10, 2026.

Largest of these carriers, 12,701 to 12,800 of 152,107, in the same order as page 1.

## The full list

This record is a row of this list. Pay by card with no account. Prices exclude VAT. CSV and Excel files with the columns this page does not show (phone, email, legal name, DBA name, USDOT number, docket number and 9 more), which open on your screen as soon as the payment clears and come by email.

- [Private fleets in the US](https://specstream.ai/data/carriers/type/private-fleet): 152,107 rows, carriers with 5 or more power units on the FMCSA register of November 10, 2026; inspections and crashes from November 10, 2024 to November 10, 2026, $1,601.07, or the new rows each week for $31.35 a month. Buy: https://specstream.ai/data/carriers/type/private-fleet

SpecStream is the live web data engine for teams and agents. It reads the carrier register, roadside inspections, crashes and operating authority that FMCSA publishes, and this page is that reading. Ask for the carriers you sell to or insure by state, city, cargo or fleet size, and new inspections, crashes and authority changes arrive in your sheet, CRM, Slack or agent as FMCSA posts them.

## Largest of these carriers, page 128

| Carrier | City | State | Power units | Drivers | Inspections | Vehicle out of service | Crashes |
| --- | --- | --- | --- | --- | --- | --- | --- |
| [Prestige Farms Inc](https://specstream.ai/data/carriers/carrier/prestige-farms-inc-charlotte-nc-494266) | Charlotte | NC | 38 | 40 | 36 | 25% | 1 |
| Smith Lawnscapes LLC | ST Johns | MI | 38 | 40 | 1 | Not listed | 0 |
| Town & Country Construction LLC | Mayville | WI | 38 | 40 | 0 | Not listed | 0 |
| A Goff Limousine & Bus Company LLC | Ruckersville | VA | 38 | 39 | 3 | Not listed | 1 |
| Crown Castle Fiber LLC | Canonsburg | PA | 38 | 39 | 2 | Not listed | 0 |
| Fischer Transportation Inc | Fenwood | WI | 38 | 39 | 0 | Not listed | 0 |
| [Gaddie Shamrock LLC](https://specstream.ai/data/carriers/carrier/gaddie-shamrock-llc-columbia-ky-646259) | Columbia | KY | 38 | 39 | 9 | 0% | 2 |
| Stout Roofing Inc | ST George | UT | 38 | 39 | 4 | Not listed | 0 |
| Thorco Inc | Coeur D Alene | ID | 38 | 39 | 0 | Not listed | 0 |
| 2M Management Group Inc | Smyrna | GA | 38 | 38 | 0 | Not listed | 0 |
| Ablehearts Administrative Services Holdings LLC | Douglasville | GA | 38 | 38 | 0 | Not listed | 0 |
| All Pro Plumbing Heating Cooling & Electrical LLC | Ontario | CA | 38 | 38 | 0 | Not listed | 0 |
| Apex Site Solutions Inc | Elk Grove | CA | 38 | 38 | 5 | Not listed | 0 |
| [Baldwin Contracting Company Inc](https://specstream.ai/data/carriers/carrier/baldwin-contracting-company-inc-chico-ca-2644352) | Chico | CA | 38 | 38 | 14 | 15.4% | 1 |
| [City Plumbing & Electric Supply Co](https://specstream.ai/data/carriers/carrier/city-plumbing-electric-supply-co-gainesville-ga-576592) | Gainesville | GA | 38 | 38 | 12 | 10% | 0 |
| Comcast of Californiamarylandpennsylvaniavirginiawest Virginia LLC | Winchester | VA | 38 | 38 | 6 | Not listed | 1 |
| [Crompco LLC](https://specstream.ai/data/carriers/carrier/crompco-llc-plymouth-meeting-pa-772384) | Plymouth Meeting | PA | 38 | 38 | 51 | 7% | 2 |
| Crossroads Trailer Sales & Services Inc | Albert Lea | MN | 38 | 38 | 7 | 40% | 1 |
| [David Bell Trucking Inc](https://specstream.ai/data/carriers/carrier/david-bell-trucking-inc-screven-ga-1220384) | Screven | GA | 38 | 38 | 22 | Not listed | 5 |
| Davis Ulmer Sprinkler Co Inc | Liverpool | NY | 38 | 38 | 9 | 14.3% | 0 |
| Eclipse Lighting & Electrical | Anaheim | CA | 38 | 38 | 6 | Not listed | 0 |
| Firetrol Protection Systems | Salt Lake City | UT | 38 | 38 | 0 | Not listed | 0 |
| [GA Trucking LLC](https://specstream.ai/data/carriers/carrier/ga-trucking-llc-artesia-nm-2063253) | Artesia | NM | 38 | 38 | 74 | 32.8% | 3 |
| Horizon Landscape Company Inc | Wyckoff | NJ | 38 | 38 | 0 | Not listed | 0 |
| [Hutch Paving Inc](https://specstream.ai/data/carriers/carrier/hutch-paving-inc-warren-mi-1557473) | Warren | MI | 38 | 38 | 16 | 37.5% | 4 |
| J F Price Co | East Weymouth | MA | 38 | 38 | 2 | Not listed | 0 |
| Jewish Association for Services for the Aged | New York | NY | 38 | 38 | 0 | Not listed | 0 |
| John Martinez Trucking LLC | Farmingdale | NY | 38 | 38 | 0 | Not listed | 0 |
| L 6 Inc | Broken Arrow | OK | 38 | 38 | 0 | Not listed | 0 |
| [Lafontaine Cadillac Buick GMC Inc](https://specstream.ai/data/carriers/carrier/lafontaine-cadillac-buick-gmc-inc-highland-mi-1427635) | Highland | MI | 38 | 38 | 5 | Not listed | 4 |
| Landarc Contracting Services Inc | Auburn Hills | MI | 38 | 38 | 0 | Not listed | 0 |
| [Linder Industrial Machinery Company](https://specstream.ai/data/carriers/carrier/linder-industrial-machinery-company-plant-city-fl-903426) | Plant City | FL | 38 | 38 | 37 | 10.5% | 4 |
| [Love Bottling Company](https://specstream.ai/data/carriers/carrier/love-bottling-company-muskogee-ok-369022) | Muskogee | OK | 38 | 38 | 11 | Not listed | 1 |
| Magellan Pipeline Company LP | Tulsa | OK | 38 | 38 | 4 | Not listed | 0 |
| [Maverick Beverage Company Texas LLC](https://specstream.ai/data/carriers/carrier/maverick-beverage-company-texas-llc-dfw-airport-tx-3884745) | DFW Airport | TX | 38 | 38 | 13 | 0% | 1 |
| Midwest Special Services Inc | ST Paul | MN | 38 | 38 | 0 | Not listed | 0 |
| Montgomery Association for Retarded Citizens | Montgomery | AL | 38 | 38 | 0 | Not listed | 0 |
| Natural Green Inc | Osseo | MN | 38 | 38 | 0 | Not listed | 0 |
| [North Valley Arbor Management Inc](https://specstream.ai/data/carriers/carrier/north-valley-arbor-management-inc-chico-ca-3408117) | Chico | CA | 38 | 38 | 20 | 27.8% | 0 |
| Peak Dist Co Inc | Salt Lake City | UT | 38 | 38 | 0 | Not listed | 0 |
| [RC Trucking Inc](https://specstream.ai/data/carriers/carrier/rc-trucking-inc-gridley-ks-531724) | Gridley | KS | 38 | 38 | 94 | 15% | 7 |
| River's Edge Ready Mix LLC | Mendota Heights | MN | 38 | 38 | 0 | Not listed | 0 |
| [Shoemaker Trucking & Excavating Inc](https://specstream.ai/data/carriers/carrier/shoemaker-trucking-excavating-inc-kirkwood-pa-574725) | Kirkwood | PA | 38 | 38 | 32 | 22.2% | 3 |
| Spartan Tool LLC | Niles | MI | 38 | 38 | 9 | 0% | 0 |
| Starkweather Roofing Inc | Phoenix | AZ | 38 | 38 | 0 | Not listed | 0 |
| Stateserv Medical of Colorado LLC | Colorado Springs | CO | 38 | 38 | 4 | Not listed | 1 |
| Stratton & Bratt Landscapes LLC | Pleasant Grove | UT | 38 | 38 | 2 | Not listed | 0 |
| [Supply New England Inc](https://specstream.ai/data/carriers/carrier/supply-new-england-inc-attleboro-ma-333507) | Attleboro | MA | 38 | 38 | 13 | 37.5% | 2 |
| Total Mechanical Systems LLC | Plainville | CT | 38 | 38 | 1 | Not listed | 0 |
| [Vern's & Son Inc](https://specstream.ai/data/carriers/carrier/vern-s-son-inc-hermiston-or-717966) | Hermiston | OR | 38 | 38 | 30 | 21.7% | 1 |
| Victorville Disposal Inc | Victorville | CA | 38 | 38 | 2 | Not listed | 0 |
| [Viramontes Express Inc](https://specstream.ai/data/carriers/carrier/viramontes-express-inc-corona-ca-811328) | Corona | CA | 38 | 38 | 37 | 39.3% | 2 |
| Wilcox County Board of Education | Camden | AL | 38 | 38 | 0 | Not listed | 0 |
| Wright Vending & Disrtibuting | Fitchburg | WI | 38 | 38 | 0 | Not listed | 0 |
| [Clearbrook Farms Inc](https://specstream.ai/data/carriers/carrier/clearbrook-farms-inc-downey-ca-2734046) | Downey | CA | 38 | 37 | 33 | 15.4% | 2 |
| [Heartland Concrete & Construction Inc](https://specstream.ai/data/carriers/carrier/heartland-concrete-construction-inc-hastings-ne-1259083) | Hastings | NE | 38 | 37 | 11 | 33.3% | 0 |
| [Hollywood Feed LLC](https://specstream.ai/data/carriers/carrier/hollywood-feed-llc-memphis-tn-977433) | Memphis | TN | 38 | 37 | 63 | 35.7% | 4 |
| Hulcher Resources Inc | Denton | TX | 38 | 37 | 6 | 40% | 0 |
| Mid-South Propane Inc | Detroit | AL | 38 | 37 | 0 | Not listed | 0 |
| [Mobile Concrete Inc](https://specstream.ai/data/carriers/carrier/mobile-concrete-inc-jesup-ga-598182) | Jesup | GA | 38 | 37 | 7 | Not listed | 3 |
| [A&s Leasing NY LLC](https://specstream.ai/data/carriers/carrier/a-s-leasing-ny-llc-troy-ny-3285477) | Troy | NY | 38 | 36 | 40 | 20.8% | 2 |
| Alhambra School District 68 | Phoenix | AZ | 38 | 36 | 0 | Not listed | 0 |
| B-Organized Insulation LLC | Charlotte | NC | 38 | 36 | 7 | Not listed | 1 |
| Dry Creek Structures LLC | Lehi | UT | 38 | 36 | 7 | 50% | 1 |
| Eagle Distributing of Memphis LLC | Memphis | TN | 38 | 36 | 3 | Not listed | 1 |
| Freeborn Mower Electric Cooperative | Albert Lea | MN | 38 | 36 | 1 | Not listed | 0 |
| [O&w Inc](https://specstream.ai/data/carriers/carrier/o-w-inc-ypsilanti-mi-22470) | Ypsilanti | MI | 38 | 36 | 6 | Not listed | 3 |
| Wagner Paving Inc | Laura | OH | 38 | 36 | 0 | Not listed | 1 |
| Armstrong Sweeping Inc | Arvada | CO | 38 | 35 | 5 | Not listed | 0 |
| [Firstline Texas Road Solutions LLC](https://specstream.ai/data/carriers/carrier/firstline-texas-road-solutions-llc-jarrell-tx-4502463) | Jarrell | TX | 38 | 35 | 1 | Not listed | 2 |
| [Ivey Construction Inc](https://specstream.ai/data/carriers/carrier/ivey-construction-inc-mineral-point-wi-766526) | Mineral Point | WI | 38 | 35 | 20 | 33.3% | 1 |
| Palmer Bus Service of Maple River Inc | Amboy | MN | 38 | 35 | 1 | Not listed | 0 |
| Sheppard Pratt Health System Inc | Towson | MD | 38 | 35 | 0 | Not listed | 0 |
| [Specialty Sales LLC](https://specstream.ai/data/carriers/carrier/specialty-sales-llc-fresno-ca-2009267) | Fresno | CA | 38 | 35 | 38 | 10.8% | 0 |
| [Triunfo Foods Import & Export Corp](https://specstream.ai/data/carriers/carrier/triunfo-foods-import-export-corp-newark-nj-245196) | Newark | NJ | 38 | 35 | 26 | 33.3% | 2 |
| [American Compressed Gases Inc](https://specstream.ai/data/carriers/carrier/american-compressed-gases-inc-old-tappan-nj-102217) | Old Tappan | NJ | 38 | 34 | 44 | 2.4% | 1 |
| [Authentic Drilling LLC](https://specstream.ai/data/carriers/carrier/authentic-drilling-llc-kiowa-co-2537363) | Kiowa | CO | 38 | 34 | 23 | 33.3% | 0 |
| [Barton Materials LLC](https://specstream.ai/data/carriers/carrier/barton-materials-llc-aurora-co-991196) | Aurora | CO | 38 | 34 | 48 | 23.7% | 0 |
| [Fayblock Materials Inc](https://specstream.ai/data/carriers/carrier/fayblock-materials-inc-fayetteville-nc-489974) | Fayetteville | NC | 38 | 34 | 124 | 18.5% | 7 |
| [Gleckler LLC](https://specstream.ai/data/carriers/carrier/gleckler-llc-jacksonville-fl-2969101) | Jacksonville | FL | 38 | 34 | 16 | 33.3% | 2 |
| [Herrman Building Materials Inc](https://specstream.ai/data/carriers/carrier/herrman-building-materials-inc-springfield-mo-81999) | Springfield | MO | 38 | 34 | 5 | 40% | 3 |
| Prairie Grain Partners LLC | Clarkfield | MN | 38 | 34 | 3 | Not listed | 1 |
| Rokstad Power East Inc | Phoenix | AZ | 38 | 34 | 1 | Not listed | 0 |
| [Coggins Construction Company LLC](https://specstream.ai/data/carriers/carrier/coggins-construction-company-llc-thomaston-ga-1552597) | Thomaston | GA | 38 | 33 | 9 | 40% | 2 |
| [Dearwester Grain Services Inc](https://specstream.ai/data/carriers/carrier/dearwester-grain-services-inc-golden-il-806797) | Golden | IL | 38 | 33 | 16 | 0% | 1 |
| Freyssinet Inc | Sterling | VA | 38 | 33 | 4 | Not listed | 0 |
| [TNT Readymix Inc](https://specstream.ai/data/carriers/carrier/tnt-readymix-inc-kingsland-ga-3118741) | Kingsland | GA | 38 | 33 | 81 | 28.6% | 4 |
| [Ada Coca Cola Bottling Company](https://specstream.ai/data/carriers/carrier/ada-coca-cola-bottling-company-ada-ok-314371) | Ada | OK | 38 | 32 | 13 | Not listed | 1 |
| Campbell's C-Ment Contracting Inc | Arvada | CO | 38 | 32 | 0 | Not listed | 0 |
| Five Star Builders Inc | Banks | OR | 38 | 32 | 5 | 40% | 1 |
| [Global Contracting Group LLC](https://specstream.ai/data/carriers/carrier/global-contracting-group-llc-wildwood-fl-2048816) | Wildwood | FL | 38 | 32 | 19 | Not listed | 1 |
| Insco Distributing Inc | San Antonio | TX | 38 | 32 | 6 | 16.7% | 0 |
| Sioux Falls Insulation Supply Inc | North Sioux City | SD | 38 | 32 | 3 | Not listed | 0 |
| [Tri-City Concrete Co LLC](https://specstream.ai/data/carriers/carrier/tri-city-concrete-co-llc-forest-city-nc-196851) | Forest City | NC | 38 | 32 | 8 | Not listed | 2 |
| [Barker Brothers Waste Inc](https://specstream.ai/data/carriers/carrier/barker-brothers-waste-inc-phoenix-az-281205) | Phoenix | AZ | 38 | 31 | 12 | Not listed | 3 |
| [Britton Industries Inc](https://specstream.ai/data/carriers/carrier/britton-industries-inc-lawrenceville-nj-1145035) | Lawrenceville | NJ | 38 | 31 | 47 | 35.3% | 7 |
| Cloverleaf Local School District | Fmcsa | OH | 38 | 31 | 0 | Not listed | 0 |
| Custom Lawn & Landscape Inc | Olathe | KS | 38 | 31 | 1 | Not listed | 0 |
| [Mid-Nebraska Disposal Inc](https://specstream.ai/data/carriers/carrier/mid-nebraska-disposal-inc-grand-island-ne-761988) | Grand Island | NE | 38 | 31 | 23 | 16.7% | 3 |
| [RL Causey Inc](https://specstream.ai/data/carriers/carrier/rl-causey-inc-murrells-inlet-sc-2208886) | Murrells Inlet | SC | 38 | 31 | 18 | Not listed | 3 |

- [Previous page](https://specstream.ai/data/carriers/type/private-fleet/page/127)
- [Next page](https://specstream.ai/data/carriers/type/private-fleet/page/129)
- [Page 1](https://specstream.ai/data/carriers/type/private-fleet)

Source: [US Department of Transportation, FMCSA Motor Carrier Census, Inspection, Crash and Licensing files](https://data.transportation.gov/Trucking-and-Motorcoaches/Company-Census-File/az4n-8mr2). Public domain (U.S. government work). Inspection and crash counts cover November 10, 2024 to November 10, 2026. Fleet size, drivers, cargo and operation are as each carrier reports them to FMCSA and can be out of date. A vehicle or driver out of service order means an inspector ordered the vehicle or driver off the road until the problem was fixed. The national rate comes from every inspection in the same window. Crashes are those state police reported to FMCSA and are not a finding of fault. This page uses US Department of Transportation data and is not endorsed or certified by the Department of Transportation or FMCSA.

Free to reuse with credit to SpecStream under [CC BY 4.0](https://creativecommons.org/licenses/by/4.0/).