# Hazardous materials carriers in the US: 34,316, page 57

Updated November 10, 2026.

Largest of these carriers, 5,601 to 5,700 of 34,316, in the same order as page 1.

## The full list

This record is a row of this list. Pay by card with no account. Prices exclude VAT. CSV and Excel files with the columns this page does not show (phone, email, legal name, DBA name, USDOT number, docket number and 9 more), which open on your screen as soon as the payment clears and come by email.

- [Hazardous materials carriers in the US](https://specstream.ai/data/carriers/type/hazmat): 34,316 rows, carriers with 5 or more power units on the FMCSA register of November 10, 2026; inspections and crashes from November 10, 2024 to November 10, 2026, $423.16, or the new rows each week for $19 a month. Buy: https://specstream.ai/data/carriers/type/hazmat

SpecStream is the live web data engine for teams and agents. It reads the carrier register, roadside inspections, crashes and operating authority that FMCSA publishes, and this page is that reading. Ask for the carriers you sell to or insure by state, city, cargo or fleet size, and new inspections, crashes and authority changes arrive in your sheet, CRM, Slack or agent as FMCSA posts them.

## Largest of these carriers, page 57

| Carrier | City | State | Power units | Drivers | Inspections | Vehicle out of service | Crashes |
| --- | --- | --- | --- | --- | --- | --- | --- |
| [Jensen's Tree Service Inc](https://specstream.ai/data/carriers/carrier/jensen-s-tree-service-inc-winston-or-697918) | Winston | OR | 39 | 26 | 5 | 0% | 2 |
| [Alfredo Towing Services LLC](https://specstream.ai/data/carriers/carrier/alfredo-towing-services-llc-plant-city-fl-3481247) | Plant City | FL | 39 | 25 | 31 | 38.9% | 1 |
| [Raydon Inc](https://specstream.ai/data/carriers/carrier/raydon-inc-breckenridge-tx-470354) | Breckenridge | TX | 39 | 25 | 20 | 36.8% | 3 |
| Tep Opco LLC | Raleigh | NC | 39 | 25 | 8 | 42.9% | 0 |
| Ultra Tech Frac Services LLC | Houston | TX | 39 | 25 | 0 | Not listed | 0 |
| [Greenbrier Hotel Corporation](https://specstream.ai/data/carriers/carrier/greenbrier-hotel-corporation-white-sulphur-spring-wv-209794) | White Sulphur Springs | WV | 39 | 24 | 37 | 0% | 0 |
| [Harrison Trucking Inc](https://specstream.ai/data/carriers/carrier/harrison-trucking-inc-rillito-az-464009) | Rillito | AZ | 39 | 24 | 29 | 12.5% | 1 |
| [Pdi Sheetz Construction Corp](https://specstream.ai/data/carriers/carrier/pdi-sheetz-construction-corp-linthicum-md-655402) | Linthicum | MD | 39 | 24 | 23 | 21.7% | 1 |
| Frank Coluccio Construction Company | Seattle | WA | 39 | 23 | 0 | Not listed | 0 |
| Jamie Oil Co Inc | Ashland | MA | 39 | 23 | 0 | Not listed | 0 |
| [Southwest Freight Inc](https://specstream.ai/data/carriers/carrier/southwest-freight-inc-houston-tx-225540) | Houston | TX | 39 | 23 | 18 | 23.5% | 0 |
| [Terra-Ace Intermediate Holdings LLC](https://specstream.ai/data/carriers/carrier/terra-ace-intermediate-holdings-llc-odessa-tx-3546277) | Odessa | TX | 39 | 23 | 17 | 23.5% | 1 |
| Aero Spray Inc | Appleton | MN | 39 | 22 | 9 | 0% | 0 |
| [RDM Transport Group LLC](https://specstream.ai/data/carriers/carrier/rdm-transport-group-llc-yonkers-ny-25982) | Yonkers | NY | 39 | 22 | 28 | 21.1% | 2 |
| [Tilley Distribution Inc](https://specstream.ai/data/carriers/carrier/tilley-distribution-inc-baltimore-md-65139) | Baltimore | MD | 39 | 22 | 67 | 11.7% | 1 |
| [Utility Tri-State Inc](https://specstream.ai/data/carriers/carrier/utility-tri-state-inc-tulsa-ok-1767147) | Tulsa | OK | 39 | 22 | 34 | 4.8% | 0 |
| Farison Lawn Care and Sports Turf Inc | Louisville | KY | 39 | 20 | 0 | Not listed | 0 |
| Highway Rehabilitation Corporation | Alden | NY | 39 | 20 | 6 | Not listed | 0 |
| Premier Excavation Inc | Pasco | WA | 39 | 20 | 3 | Not listed | 0 |
| United Agronomy LLC | Berthold | ND | 39 | 20 | 5 | Not listed | 0 |
| Howell Paving Inc | Mattoon | IL | 39 | 19 | 3 | Not listed | 0 |
| [J Ross Express Inc](https://specstream.ai/data/carriers/carrier/j-ross-express-inc-cleveland-oh-1202839) | Cleveland | OH | 39 | 19 | 15 | 81.8% | 2 |
| [Corey Oil LTD](https://specstream.ai/data/carriers/carrier/corey-oil-ltd-oconomowoc-wi-603882) | Oconomowoc | WI | 39 | 18 | 15 | 14.3% | 1 |
| [Lighthouse Environmental Services Inc](https://specstream.ai/data/carriers/carrier/lighthouse-environmental-services-inc-houston-tx-1664862) | Houston | TX | 39 | 18 | 27 | 23.1% | 0 |
| [Multifab Inc](https://specstream.ai/data/carriers/carrier/multifab-inc-spokane-wa-540502) | Spokane | WA | 39 | 18 | 30 | 16.7% | 0 |
| [Spencer Construction LLC](https://specstream.ai/data/carriers/carrier/spencer-construction-llc-tucson-az-3268710) | Tucson | AZ | 39 | 18 | 15 | 20% | 0 |
| Daniel L Ribbe Trucking Inc | Tilton | IL | 39 | 15 | 7 | Not listed | 0 |
| Doyon Energy Services LLC | Fairbanks | AK | 39 | 15 | 3 | Not listed | 0 |
| Now Or Never Trucking Inc | Greeley | CO | 39 | 15 | 1 | Not listed | 1 |
| Wick Buildings Inc | Mazomanie | WI | 39 | 15 | 3 | Not listed | 0 |
| Mosark LLC | Raton | NM | 39 | 13 | 6 | 0% | 0 |
| [Xport Services Incorporated](https://specstream.ai/data/carriers/carrier/xport-services-incorporated-newark-nj-671679) | Newark | NJ | 39 | 13 | 12 | 16.7% | 0 |
| Bartlett Oilfield Service Inc | Bairoil | WY | 39 | 12 | 1 | Not listed | 0 |
| [F D Thomas Inc](https://specstream.ai/data/carriers/carrier/f-d-thomas-inc-central-point-or-434705) | Central Point | OR | 39 | 11 | 33 | 17.2% | 0 |
| [Transource Truck & Equipment Inc](https://specstream.ai/data/carriers/carrier/transource-truck-equipment-inc-sioux-falls-sd-3073145) | Sioux Falls | SD | 39 | 11 | 12 | 50% | 1 |
| [Atsalis Brothers Painting Co](https://specstream.ai/data/carriers/carrier/atsalis-brothers-painting-co-clinton-township-mi-419384) | Clinton Township | MI | 39 | 10 | 11 | 66.7% | 1 |
| [Blackjack Chemical Logistics LLC](https://specstream.ai/data/carriers/carrier/blackjack-chemical-logistics-llc-lubbock-tx-4230495) | Lubbock | TX | 39 | 8 | 19 | 18.8% | 1 |
| Continental Maritime of San Diego LLC | San Diego | CA | 39 | 8 | 4 | Not listed | 0 |
| [J Swanton Fuel Oil Co Inc](https://specstream.ai/data/carriers/carrier/j-swanton-fuel-oil-co-inc-atlantic-highlands-nj-2515285) | Atlantic Highlands | NJ | 39 | 8 | 20 | 0% | 2 |
| Dexxon Inc | Kiefer | OK | 39 | 7 | 2 | Not listed | 1 |
| Avidwater LLC | Fresno | CA | 39 | 4 | 1 | Not listed | 0 |
| [Crisp & Crisp Inc](https://specstream.ai/data/carriers/carrier/crisp-crisp-inc-robbinsville-nc-437612) | Robbinsville | NC | 38 | 120 | 70 | 14.3% | 2 |
| [Aloha Petroleum LTD](https://specstream.ai/data/carriers/carrier/aloha-petroleum-ltd-kapolei-hi-571797) | Kapolei | HI | 38 | 80 | 14 | 7.1% | 0 |
| [Ulf Janesville LLC](https://specstream.ai/data/carriers/carrier/ulf-janesville-llc-janesville-wi-2998272) | Janesville | WI | 38 | 72 | 27 | 6.2% | 4 |
| Latx Operations LLC | Waskom | TX | 38 | 60 | 3 | Not listed | 0 |
| [Sanders Supply Inc](https://specstream.ai/data/carriers/carrier/sanders-supply-inc-hot-springs-ar-112328) | Hot Springs | AR | 38 | 60 | 7 | Not listed | 2 |
| Total Western Inc | Fellows | CA | 38 | 60 | 1 | Not listed | 0 |
| Town of Windsor | Windsor | CO | 38 | 58 | 0 | Not listed | 0 |
| [Heartland Asphalt Inc](https://specstream.ai/data/carriers/carrier/heartland-asphalt-inc-mason-city-ia-549530) | Mason City | IA | 38 | 56 | 10 | Not listed | 0 |
| [Baton Rouge Cargo Service Inc](https://specstream.ai/data/carriers/carrier/baton-rouge-cargo-service-inc-baton-rouge-la-243896) | Baton Rouge | LA | 38 | 54 | 49 | 20.8% | 5 |
| Bechtel Jacobs Company LLC | Oak Ridge | TN | 38 | 53 | 0 | Not listed | 0 |
| Commonwealth Paving Incorporated | Manassas | VA | 38 | 50 | 2 | Not listed | 1 |
| [Appalachia Transfer Services LLC](https://specstream.ai/data/carriers/carrier/appalachia-transfer-services-llc-eighty-four-pa-2917820) | Eighty Four | PA | 38 | 49 | 48 | 6.9% | 3 |
| [Samuel J Piazza & Son Inc](https://specstream.ai/data/carriers/carrier/samuel-j-piazza-son-inc-south-gate-ca-391314) | South Gate | CA | 38 | 49 | 144 | 7.6% | 0 |
| [DBS Residential Solutions Inc](https://specstream.ai/data/carriers/carrier/dbs-residential-solutions-inc-duluth-mn-2334449) | Duluth | MN | 38 | 48 | 28 | 35% | 0 |
| [Awt Environmental Services Inc](https://specstream.ai/data/carriers/carrier/awt-environmental-services-inc-old-bridge-nj-266514) | Old Bridge | NJ | 38 | 47 | 25 | 28.6% | 2 |
| [Cross Express Company](https://specstream.ai/data/carriers/carrier/cross-express-company-mt-prospect-il-1375756) | MT Prospect | IL | 38 | 47 | 86 | 22% | 2 |
| [Logan Agri-Service Inc](https://specstream.ai/data/carriers/carrier/logan-agri-service-inc-griggsville-il-501740) | Griggsville | IL | 38 | 47 | 18 | 13.3% | 2 |
| [RJR Transportation Inc](https://specstream.ai/data/carriers/carrier/rjr-transportation-inc-lathrop-ca-629200) | Lathrop | CA | 38 | 47 | 67 | 13.7% | 0 |
| [A-1 Rocket Energy Services LLC](https://specstream.ai/data/carriers/carrier/a-1-rocket-energy-services-llc-floresville-tx-3109252) | Floresville | TX | 38 | 46 | 42 | 35.7% | 3 |
| [Penn Valley Gas Inc](https://specstream.ai/data/carriers/carrier/penn-valley-gas-inc-telford-pa-267167) | Telford | PA | 38 | 45 | 35 | 0% | 3 |
| [Jolma Utilities LLC](https://specstream.ai/data/carriers/carrier/jolma-utilities-llc-ashland-wi-4003962) | Ashland | WI | 38 | 44 | 15 | 41.7% | 0 |
| [Roads Inc of NWF](https://specstream.ai/data/carriers/carrier/roads-inc-of-nwf-cantonment-fl-859570) | Cantonment | FL | 38 | 44 | 45 | 29.4% | 2 |
| [Greens Energy Services Inc](https://specstream.ai/data/carriers/carrier/greens-energy-services-inc-orlando-fl-824016) | Orlando | FL | 38 | 43 | 51 | 6.7% | 1 |
| Burk Royalty Co LTD | Wichita Falls | TX | 38 | 42 | 5 | 20% | 0 |
| [RLM Underground LLC](https://specstream.ai/data/carriers/carrier/rlm-underground-llc-kansas-city-ks-2963412) | Kansas City | KS | 38 | 42 | 30 | 81.8% | 1 |
| [United Contractors Inc](https://specstream.ai/data/carriers/carrier/united-contractors-inc-grimes-ia-179912) | Grimes | IA | 38 | 42 | 13 | 25% | 0 |
| [A H Hermel Candy and Tobacco Company](https://specstream.ai/data/carriers/carrier/a-h-hermel-candy-and-tobacco-company-mankato-mn-631647) | Mankato | MN | 38 | 40 | 23 | 8.3% | 0 |
| [BTD Holding Corp](https://specstream.ai/data/carriers/carrier/btd-holding-corp-chelsea-ma-245198) | Chelsea | MA | 38 | 40 | 15 | Not listed | 1 |
| [Orion Freight Services Inc](https://specstream.ai/data/carriers/carrier/orion-freight-services-inc-carson-ca-792157) | Carson | CA | 38 | 40 | 44 | 14.8% | 0 |
| [Child Truck Line Inc](https://specstream.ai/data/carriers/carrier/child-truck-line-inc-ridgefield-wa-184230) | Ridgefield | WA | 38 | 39 | 32 | 10% | 1 |
| [Gaddie Shamrock LLC](https://specstream.ai/data/carriers/carrier/gaddie-shamrock-llc-columbia-ky-646259) | Columbia | KY | 38 | 39 | 9 | 0% | 2 |
| [Impetus LLC](https://specstream.ai/data/carriers/carrier/impetus-llc-el-paso-tx-3058664) | El Paso | TX | 38 | 39 | 696 | 8.2% | 1 |
| Thorco Inc | Coeur D Alene | ID | 38 | 39 | 0 | Not listed | 0 |
| [Aim Expedited Services LLC](https://specstream.ai/data/carriers/carrier/aim-expedited-services-llc-oak-creek-wi-2150345) | Oak Creek | WI | 38 | 38 | 37 | 24.1% | 1 |
| [B&B RV Express LLC](https://specstream.ai/data/carriers/carrier/b-b-rv-express-llc-lake-arrowhead-ca-241140) | Lake Arrowhead | CA | 38 | 38 | 53 | 9.3% | 0 |
| [Baldwin Contracting Company Inc](https://specstream.ai/data/carriers/carrier/baldwin-contracting-company-inc-chico-ca-2644352) | Chico | CA | 38 | 38 | 14 | 15.4% | 1 |
| Comcast of Californiamarylandpennsylvaniavirginiawest Virginia LLC | Winchester | VA | 38 | 38 | 6 | Not listed | 1 |
| [K3 Towing Recovery and Transport Inc](https://specstream.ai/data/carriers/carrier/k3-towing-recovery-and-transport-inc-amarillo-tx-1688968) | Amarillo | TX | 38 | 38 | 13 | 40% | 3 |
| [Kansas City Drayage LLC](https://specstream.ai/data/carriers/carrier/kansas-city-drayage-llc-kansas-city-mo-3412923) | Kansas City | MO | 38 | 38 | 51 | 24.2% | 1 |
| [Ken's Towing & Service LLC](https://specstream.ai/data/carriers/carrier/ken-s-towing-service-llc-pikeville-ky-1161134) | Pikeville | KY | 38 | 38 | 89 | 22.6% | 0 |
| [Pacific Trucking Guam Inc](https://specstream.ai/data/carriers/carrier/pacific-trucking-guam-inc-barrigada-gu-1670706) | Barrigada | GU | 38 | 38 | 143 | 16.4% | 0 |
| [Pro Transport Savannah Inc](https://specstream.ai/data/carriers/carrier/pro-transport-savannah-inc-medley-fl-2529657) | Medley | FL | 38 | 38 | 51 | 63.2% | 1 |
| [Quality Car Shippers LLC](https://specstream.ai/data/carriers/carrier/quality-car-shippers-llc-murrieta-ca-2350131) | Murrieta | CA | 38 | 38 | 55 | 31% | 3 |
| Stateserv Medical of Colorado LLC | Colorado Springs | CO | 38 | 38 | 4 | Not listed | 1 |
| [Strength Transportation Management](https://specstream.ai/data/carriers/carrier/strength-transportation-management-orange-ca-2755992) | Orange | CA | 38 | 38 | 35 | 25.8% | 1 |
| [Cobra Logistics Inc](https://specstream.ai/data/carriers/carrier/cobra-logistics-inc-secaucus-nj-1128386) | Secaucus | NJ | 38 | 37 | 41 | 33.3% | 6 |
| Mid-South Propane Inc | Detroit | AL | 38 | 37 | 0 | Not listed | 0 |
| Wagner Paving Inc | Laura | OH | 38 | 36 | 0 | Not listed | 1 |
| [Best Way Logistics Inc](https://specstream.ai/data/carriers/carrier/best-way-logistics-inc-west-chester-oh-3058638) | West Chester | OH | 38 | 35 | 105 | 33.3% | 6 |
| [Firstline Texas Road Solutions LLC](https://specstream.ai/data/carriers/carrier/firstline-texas-road-solutions-llc-jarrell-tx-4502463) | Jarrell | TX | 38 | 35 | 1 | Not listed | 2 |
| [Specialty Sales LLC](https://specstream.ai/data/carriers/carrier/specialty-sales-llc-fresno-ca-2009267) | Fresno | CA | 38 | 35 | 38 | 10.8% | 0 |
| [Swain Oil Transport](https://specstream.ai/data/carriers/carrier/swain-oil-transport-san-diego-ca-1630325) | San Diego | CA | 38 | 35 | 39 | 21.1% | 0 |
| [Triunfo Foods Import & Export Corp](https://specstream.ai/data/carriers/carrier/triunfo-foods-import-export-corp-newark-nj-245196) | Newark | NJ | 38 | 35 | 26 | 33.3% | 2 |
| [American Compressed Gases Inc](https://specstream.ai/data/carriers/carrier/american-compressed-gases-inc-old-tappan-nj-102217) | Old Tappan | NJ | 38 | 34 | 44 | 2.4% | 1 |
| [Barton Materials LLC](https://specstream.ai/data/carriers/carrier/barton-materials-llc-aurora-co-991196) | Aurora | CO | 38 | 34 | 48 | 23.7% | 0 |
| [KMB Trucking LLC](https://specstream.ai/data/carriers/carrier/kmb-trucking-llc-atoka-ok-2126579) | Atoka | OK | 38 | 34 | 84 | 23.8% | 6 |
| [FTS Delivery SW LLC](https://specstream.ai/data/carriers/carrier/fts-delivery-sw-llc-saint-louis-mo-3187444) | Saint Louis | MO | 38 | 33 | 58 | 18.4% | 0 |
| [Sheehy Express Inc](https://specstream.ai/data/carriers/carrier/sheehy-express-inc-waterloo-wi-2517265) | Waterloo | WI | 38 | 33 | 37 | 26.9% | 2 |
| [Global Contracting Group LLC](https://specstream.ai/data/carriers/carrier/global-contracting-group-llc-wildwood-fl-2048816) | Wildwood | FL | 38 | 32 | 19 | Not listed | 1 |

- [Previous page](https://specstream.ai/data/carriers/type/hazmat/page/56)
- [Next page](https://specstream.ai/data/carriers/type/hazmat/page/58)
- [Page 1](https://specstream.ai/data/carriers/type/hazmat)

Source: [US Department of Transportation, FMCSA Motor Carrier Census, Inspection, Crash and Licensing files](https://data.transportation.gov/Trucking-and-Motorcoaches/Company-Census-File/az4n-8mr2). Public domain (U.S. government work). Inspection and crash counts cover November 10, 2024 to November 10, 2026. Fleet size, drivers, cargo and operation are as each carrier reports them to FMCSA and can be out of date. A vehicle or driver out of service order means an inspector ordered the vehicle or driver off the road until the problem was fixed. The national rate comes from every inspection in the same window. Crashes are those state police reported to FMCSA and are not a finding of fault. This page uses US Department of Transportation data and is not endorsed or certified by the Department of Transportation or FMCSA.

Free to reuse with credit to SpecStream under [CC BY 4.0](https://creativecommons.org/licenses/by/4.0/).