# General freight carriers in the US: 119,951, page 122

Updated November 10, 2026.

Largest of these carriers, 12,101 to 12,200 of 119,951, in the same order as page 1.

## The full list

This record is a row of this list. Pay by card with no account. Prices exclude VAT. CSV and Excel files with the columns this page does not show (phone, email, legal name, DBA name, USDOT number, docket number and 9 more), which open on your screen as soon as the payment clears and come by email.

- [General freight carriers in the US](https://specstream.ai/data/carriers/cargo/general-freight): 119,951 rows, carriers with 5 or more power units on the FMCSA register of November 10, 2026; inspections and crashes from November 10, 2024 to November 10, 2026, $1,279.51, or the new rows each week for $19 a month. Buy: https://specstream.ai/data/carriers/cargo/general-freight

SpecStream is the live web data engine for teams and agents. It reads the carrier register, roadside inspections, crashes and operating authority that FMCSA publishes, and this page is that reading. Ask for the carriers you sell to or insure by state, city, cargo or fleet size, and new inspections, crashes and authority changes arrive in your sheet, CRM, Slack or agent as FMCSA posts them.

## Largest of these carriers, page 122

| Carrier | City | State | Power units | Drivers | Inspections | Vehicle out of service | Crashes |
| --- | --- | --- | --- | --- | --- | --- | --- |
| [Transmotion Inc](https://specstream.ai/data/carriers/carrier/transmotion-inc-downers-grove-il-2466782) | Downers Grove | IL | 38 | 42 | 65 | 17.6% | 4 |
| [Atlantic Transportation LLC](https://specstream.ai/data/carriers/carrier/atlantic-transportation-llc-fort-worth-tx-3783228) | Fort Worth | TX | 38 | 41 | 200 | 25.5% | 7 |
| Duncan Supply Company Inc | Indianapolis | IN | 38 | 41 | 5 | Not listed | 0 |
| [International Trucking Group Inc](https://specstream.ai/data/carriers/carrier/international-trucking-group-inc-melville-ny-1793851) | Melville | NY | 38 | 41 | 16 | 28.6% | 0 |
| RMC Foods Inc | Saint George | UT | 38 | 41 | 0 | Not listed | 0 |
| [A H Hermel Candy and Tobacco Company](https://specstream.ai/data/carriers/carrier/a-h-hermel-candy-and-tobacco-company-mankato-mn-631647) | Mankato | MN | 38 | 40 | 23 | 8.3% | 0 |
| [BTD Holding Corp](https://specstream.ai/data/carriers/carrier/btd-holding-corp-chelsea-ma-245198) | Chelsea | MA | 38 | 40 | 15 | Not listed | 1 |
| [Cookie Carriers Inc](https://specstream.ai/data/carriers/carrier/cookie-carriers-inc-butler-in-434588) | Butler | IN | 38 | 40 | 65 | 41.4% | 4 |
| DPN Logistics LLC | Portsmouth | VA | 38 | 40 | 4 | Not listed | 0 |
| [Fateh Carriers Inc](https://specstream.ai/data/carriers/carrier/fateh-carriers-inc-eugene-or-3086782) | Eugene | OR | 38 | 40 | 138 | 33.7% | 6 |
| Globalvend Logistics LLC | Apopka | FL | 38 | 40 | 0 | Not listed | 0 |
| [L and H Industrial Inc](https://specstream.ai/data/carriers/carrier/l-and-h-industrial-inc-gillette-wy-520198) | Gillette | WY | 38 | 40 | 13 | 14.3% | 0 |
| [Orion Freight Services Inc](https://specstream.ai/data/carriers/carrier/orion-freight-services-inc-carson-ca-792157) | Carson | CA | 38 | 40 | 44 | 14.8% | 0 |
| [Royal Flush Logistics Inc](https://specstream.ai/data/carriers/carrier/royal-flush-logistics-inc-bolingbrook-il-3473104) | Bolingbrook | IL | 38 | 40 | 105 | 33.3% | 5 |
| [T & T Produce Inc](https://specstream.ai/data/carriers/carrier/t-t-produce-inc-ringgold-ga-562965) | Ringgold | GA | 38 | 40 | 29 | 9.1% | 8 |
| [Volk Transfer Inc](https://specstream.ai/data/carriers/carrier/volk-transfer-inc-mankato-mn-646587) | Mankato | MN | 38 | 40 | 48 | 39.1% | 1 |
| Williams Last Mile Home Logistics LLC | Vandalia | OH | 38 | 40 | 0 | Not listed | 0 |
| Z Brothers Express Inc | Crown Point | IN | 38 | 40 | 0 | Not listed | 0 |
| [Brink Truck Lines Inc](https://specstream.ai/data/carriers/carrier/brink-truck-lines-inc-holland-mi-157881) | Holland | MI | 38 | 39 | 31 | 0% | 2 |
| [Child Truck Line Inc](https://specstream.ai/data/carriers/carrier/child-truck-line-inc-ridgefield-wa-184230) | Ridgefield | WA | 38 | 39 | 32 | 10% | 1 |
| [Impetus LLC](https://specstream.ai/data/carriers/carrier/impetus-llc-el-paso-tx-3058664) | El Paso | TX | 38 | 39 | 696 | 8.2% | 1 |
| [S2pak LLC](https://specstream.ai/data/carriers/carrier/s2pak-llc-harrisonburg-va-2185182) | Harrisonburg | VA | 38 | 39 | 66 | 25% | 1 |
| Abb Express LLC | Madison | WI | 38 | 38 | 0 | Not listed | 0 |
| [Advanced Trucking LLC](https://specstream.ai/data/carriers/carrier/advanced-trucking-llc-indianapolis-in-2908081) | Indianapolis | IN | 38 | 38 | 65 | 3.7% | 0 |
| [Aim Expedited Services LLC](https://specstream.ai/data/carriers/carrier/aim-expedited-services-llc-oak-creek-wi-2150345) | Oak Creek | WI | 38 | 38 | 37 | 24.1% | 1 |
| All Pro Plumbing Heating Cooling & Electrical LLC | Ontario | CA | 38 | 38 | 0 | Not listed | 0 |
| [Arijet Corporation](https://specstream.ai/data/carriers/carrier/arijet-corporation-ontario-ca-2599577) | Ontario | CA | 38 | 38 | 12 | 60% | 1 |
| [Barr Transportation Corp](https://specstream.ai/data/carriers/carrier/barr-transportation-corp-auburn-ny-142787) | Auburn | NY | 38 | 38 | 43 | 30.8% | 0 |
| [BG Advance Solutions Inc](https://specstream.ai/data/carriers/carrier/bg-advance-solutions-inc-schaumburg-il-3128356) | Schaumburg | IL | 38 | 38 | 157 | 33.3% | 2 |
| [Big Red Freight Systems Inc](https://specstream.ai/data/carriers/carrier/big-red-freight-systems-inc-mckinney-tx-1311019) | Mckinney | TX | 38 | 38 | 141 | 16% | 3 |
| Comcast of Californiamarylandpennsylvaniavirginiawest Virginia LLC | Winchester | VA | 38 | 38 | 6 | Not listed | 1 |
| [Corb Inc](https://specstream.ai/data/carriers/carrier/corb-inc-addison-il-2199066) | Addison | IL | 38 | 38 | 14 | 57.1% | 1 |
| Crossroads Trailer Sales & Services Inc | Albert Lea | MN | 38 | 38 | 7 | 40% | 1 |
| [David Bell Trucking Inc](https://specstream.ai/data/carriers/carrier/david-bell-trucking-inc-screven-ga-1220384) | Screven | GA | 38 | 38 | 22 | Not listed | 5 |
| Davis Ulmer Sprinkler Co Inc | Liverpool | NY | 38 | 38 | 9 | 14.3% | 0 |
| [Delgado Logistics LLC](https://specstream.ai/data/carriers/carrier/delgado-logistics-llc-rockwall-tx-3517673) | Rockwall | TX | 38 | 38 | 208 | 31.5% | 7 |
| Eclipse Lighting & Electrical | Anaheim | CA | 38 | 38 | 6 | Not listed | 0 |
| [Edward K Inc](https://specstream.ai/data/carriers/carrier/edward-k-inc-boyd-tx-1208608) | Boyd | TX | 38 | 38 | 43 | 26.2% | 0 |
| Exclusive Landscaping Group Inc | Orlando | FL | 38 | 38 | 7 | 16.7% | 0 |
| [Extreme Carriers Inc](https://specstream.ai/data/carriers/carrier/extreme-carriers-inc-norridge-il-2635389) | Norridge | IL | 38 | 38 | 22 | 35.7% | 1 |
| [Extreme Materials Inc](https://specstream.ai/data/carriers/carrier/extreme-materials-inc-summerville-sc-1905971) | Summerville | SC | 38 | 38 | 99 | 47.1% | 3 |
| [F & a Carriers Inc](https://specstream.ai/data/carriers/carrier/f-a-carriers-inc-laredo-tx-1538420) | Laredo | TX | 38 | 38 | 134 | 23.9% | 2 |
| [GA Trucking LLC](https://specstream.ai/data/carriers/carrier/ga-trucking-llc-artesia-nm-2063253) | Artesia | NM | 38 | 38 | 74 | 32.8% | 3 |
| Go Ground Xpress LLC | Plymouth Meeting | PA | 38 | 38 | 0 | Not listed | 0 |
| [Green Drayage Systems Inc](https://specstream.ai/data/carriers/carrier/green-drayage-systems-inc-mira-loma-ca-1929684) | Mira Loma | CA | 38 | 38 | 73 | 21.4% | 6 |
| [Hendrix Hauling Company Inc](https://specstream.ai/data/carriers/carrier/hendrix-hauling-company-inc-jesup-ga-226185) | Jesup | GA | 38 | 38 | 10 | 80% | 2 |
| Horizon Landscape Company Inc | Wyckoff | NJ | 38 | 38 | 0 | Not listed | 0 |
| [Jerry Mcclure Trucking Inc](https://specstream.ai/data/carriers/carrier/jerry-mcclure-trucking-inc-cooter-mo-77544) | Cooter | MO | 38 | 38 | 82 | 38.1% | 2 |
| [K3 Towing Recovery and Transport Inc](https://specstream.ai/data/carriers/carrier/k3-towing-recovery-and-transport-inc-amarillo-tx-1688968) | Amarillo | TX | 38 | 38 | 13 | 40% | 3 |
| [Kansas City Drayage LLC](https://specstream.ai/data/carriers/carrier/kansas-city-drayage-llc-kansas-city-mo-3412923) | Kansas City | MO | 38 | 38 | 51 | 24.2% | 1 |
| [Ken's Towing & Service LLC](https://specstream.ai/data/carriers/carrier/ken-s-towing-service-llc-pikeville-ky-1161134) | Pikeville | KY | 38 | 38 | 89 | 22.6% | 0 |
| [Lafontaine Cadillac Buick GMC Inc](https://specstream.ai/data/carriers/carrier/lafontaine-cadillac-buick-gmc-inc-highland-mi-1427635) | Highland | MI | 38 | 38 | 5 | Not listed | 4 |
| [Land Trucking LLC](https://specstream.ai/data/carriers/carrier/land-trucking-llc-dearborn-mi-2580421) | Dearborn | MI | 38 | 38 | 74 | 30.8% | 5 |
| [Maverick Beverage Company Texas LLC](https://specstream.ai/data/carriers/carrier/maverick-beverage-company-texas-llc-dfw-airport-tx-3884745) | DFW Airport | TX | 38 | 38 | 13 | 0% | 1 |
| [Maynard Beachy Trucking LTD](https://specstream.ai/data/carriers/carrier/maynard-beachy-trucking-ltd-sugarcreek-oh-900147) | Sugarcreek | OH | 38 | 38 | 57 | 10% | 4 |
| [Mfour Transport Inc](https://specstream.ai/data/carriers/carrier/mfour-transport-inc-naperville-il-3112567) | Naperville | IL | 38 | 38 | 198 | 20% | 4 |
| [Mfreight Inc](https://specstream.ai/data/carriers/carrier/mfreight-inc-schaumburg-il-3873610) | Schaumburg | IL | 38 | 38 | 59 | 25% | 2 |
| [Miami Cement LLC](https://specstream.ai/data/carriers/carrier/miami-cement-llc-doral-fl-3173275) | Doral | FL | 38 | 38 | 10 | 0% | 0 |
| Midwest Special Services Inc | ST Paul | MN | 38 | 38 | 0 | Not listed | 0 |
| [MKP Enterprises LLC](https://specstream.ai/data/carriers/carrier/mkp-enterprises-llc-alice-tx-2207464) | Alice | TX | 38 | 38 | 14 | 14.3% | 0 |
| [Octagon Group Inc](https://specstream.ai/data/carriers/carrier/octagon-group-inc-arlington-heights-il-3370352) | Arlington Heights | IL | 38 | 38 | 62 | 23.8% | 3 |
| [Pacific Trucking Guam Inc](https://specstream.ai/data/carriers/carrier/pacific-trucking-guam-inc-barrigada-gu-1670706) | Barrigada | GU | 38 | 38 | 143 | 16.4% | 0 |
| [Premier Motor Lines Inc](https://specstream.ai/data/carriers/carrier/premier-motor-lines-inc-jersey-city-nj-676245) | Jersey City | NJ | 38 | 38 | 59 | 23.1% | 3 |
| [Pro Transport Savannah Inc](https://specstream.ai/data/carriers/carrier/pro-transport-savannah-inc-medley-fl-2529657) | Medley | FL | 38 | 38 | 51 | 63.2% | 1 |
| [Prosperity Transportation LLC](https://specstream.ai/data/carriers/carrier/prosperity-transportation-llc-springtown-tx-2902356) | Springtown | TX | 38 | 38 | 115 | 21.9% | 4 |
| [Quartz Transportation LLC](https://specstream.ai/data/carriers/carrier/quartz-transportation-llc-rancho-cucamonga-ca-3168539) | Rancho Cucamonga | CA | 38 | 38 | 246 | 31.2% | 1 |
| [R K Transport Inc](https://specstream.ai/data/carriers/carrier/r-k-transport-inc-owensville-in-787670) | Owensville | IN | 38 | 38 | 58 | 15% | 4 |
| [RC Trucking Inc](https://specstream.ai/data/carriers/carrier/rc-trucking-inc-gridley-ks-531724) | Gridley | KS | 38 | 38 | 94 | 15% | 7 |
| [River City Transport Inc](https://specstream.ai/data/carriers/carrier/river-city-transport-inc-dubuque-ia-3437344) | Dubuque | IA | 38 | 38 | 67 | 17.2% | 1 |
| [Royal T&T Operations LLC](https://specstream.ai/data/carriers/carrier/royal-t-t-operations-llc-ringgold-ga-4533733) | Ringgold | GA | 38 | 38 | 9 | 14.3% | 2 |
| Ryan Cargo LLC | Lyons | IL | 38 | 38 | 0 | Not listed | 0 |
| [Scorpion Express Logistics Corp](https://specstream.ai/data/carriers/carrier/scorpion-express-logistics-corp-burr-ridge-il-2579588) | Burr Ridge | IL | 38 | 38 | 44 | 31.2% | 6 |
| [Shoemaker Trucking & Excavating Inc](https://specstream.ai/data/carriers/carrier/shoemaker-trucking-excavating-inc-kirkwood-pa-574725) | Kirkwood | PA | 38 | 38 | 32 | 22.2% | 3 |
| [Sugar Creek Transportation Inc](https://specstream.ai/data/carriers/carrier/sugar-creek-transportation-inc-bloomington-ca-2523185) | Bloomington | CA | 38 | 38 | 77 | 35.1% | 0 |
| [Terza Trucking Inc](https://specstream.ai/data/carriers/carrier/terza-trucking-inc-burr-ridge-il-3774567) | Burr Ridge | IL | 38 | 38 | 105 | 40% | 3 |
| Total Mechanical Systems LLC | Plainville | CT | 38 | 38 | 1 | Not listed | 0 |
| [Viramontes Express Inc](https://specstream.ai/data/carriers/carrier/viramontes-express-inc-corona-ca-811328) | Corona | CA | 38 | 38 | 37 | 39.3% | 2 |
| [3 Sisters Logistics LLC](https://specstream.ai/data/carriers/carrier/3-sisters-logistics-llc-teutopolis-il-3383366) | Teutopolis | IL | 38 | 37 | 29 | 0% | 1 |
| [B & H Freight Line Inc](https://specstream.ai/data/carriers/carrier/b-h-freight-line-inc-clinton-mo-70173) | Clinton | MO | 38 | 37 | 46 | 6.1% | 2 |
| [Cobra Logistics Inc](https://specstream.ai/data/carriers/carrier/cobra-logistics-inc-secaucus-nj-1128386) | Secaucus | NJ | 38 | 37 | 41 | 33.3% | 6 |
| [Hollywood Feed LLC](https://specstream.ai/data/carriers/carrier/hollywood-feed-llc-memphis-tn-977433) | Memphis | TN | 38 | 37 | 63 | 35.7% | 4 |
| Leafly Transportation LLC | Hamilton | OH | 38 | 37 | 0 | Not listed | 0 |
| [Nka Transportation Inc](https://specstream.ai/data/carriers/carrier/nka-transportation-inc-sidney-oh-1316346) | Sidney | OH | 38 | 37 | 16 | 14.3% | 3 |
| [RJR Transportation Company](https://specstream.ai/data/carriers/carrier/rjr-transportation-company-el-paso-il-699434) | El Paso | IL | 38 | 37 | 51 | 11.8% | 4 |
| [S & D Trucking LLC](https://specstream.ai/data/carriers/carrier/s-d-trucking-llc-odessa-tx-2302763) | Odessa | TX | 38 | 37 | 19 | 42.1% | 1 |
| [Skyview Farms Inc](https://specstream.ai/data/carriers/carrier/skyview-farms-inc-gothenburg-ne-288779) | Gothenburg | NE | 38 | 37 | 89 | 9.8% | 2 |
| [Smooth Operators Inc](https://specstream.ai/data/carriers/carrier/smooth-operators-inc-darien-wi-438760) | Darien | WI | 38 | 37 | 34 | 31.6% | 3 |
| [Southerland Transport LLC](https://specstream.ai/data/carriers/carrier/southerland-transport-llc-antioch-tn-912915) | Antioch | TN | 38 | 37 | 116 | 15.6% | 4 |
| [Dowell Express Inc](https://specstream.ai/data/carriers/carrier/dowell-express-inc-jefferson-ga-574234) | Jefferson | GA | 38 | 36 | 77 | 29.6% | 4 |
| Dry Creek Structures LLC | Lehi | UT | 38 | 36 | 7 | 50% | 1 |
| [Gerardo Ortiz Priority Freight Lines Inc](https://specstream.ai/data/carriers/carrier/gerardo-ortiz-priority-freight-lines-inc-el-paso-tx-998388) | El Paso | TX | 38 | 36 | 87 | 8.8% | 6 |
| [Heding Truck Service Inc](https://specstream.ai/data/carriers/carrier/heding-truck-service-inc-union-center-wi-74368) | Union Center | WI | 38 | 36 | 69 | 23.3% | 5 |
| [KSX Transportation LLC](https://specstream.ai/data/carriers/carrier/ksx-transportation-llc-harlan-ia-3096024) | Harlan | IA | 38 | 36 | 32 | 23.1% | 0 |
| [Morrell & Morrell LP](https://specstream.ai/data/carriers/carrier/morrell-morrell-lp-elk-river-mn-1019356) | Elk River | MN | 38 | 36 | 49 | 28.6% | 2 |
| [Transcold LLC](https://specstream.ai/data/carriers/carrier/transcold-llc-springdale-ar-3264958) | Springdale | AR | 38 | 36 | 68 | 7.1% | 4 |
| [Bartels Truck Line Inc](https://specstream.ai/data/carriers/carrier/bartels-truck-line-inc-winthrop-mn-522095) | Winthrop | MN | 38 | 35 | 55 | 7.4% | 0 |
| [Best Way Logistics Inc](https://specstream.ai/data/carriers/carrier/best-way-logistics-inc-west-chester-oh-3058638) | West Chester | OH | 38 | 35 | 105 | 33.3% | 6 |
| Clausen Supply Co | Clinton | IA | 38 | 35 | 7 | Not listed | 0 |
| [Firstline Texas Road Solutions LLC](https://specstream.ai/data/carriers/carrier/firstline-texas-road-solutions-llc-jarrell-tx-4502463) | Jarrell | TX | 38 | 35 | 1 | Not listed | 2 |
| [J&D Transportation Inc](https://specstream.ai/data/carriers/carrier/j-d-transportation-inc-long-beach-ca-2344239) | Long Beach | CA | 38 | 35 | 72 | 40.6% | 1 |

- [Previous page](https://specstream.ai/data/carriers/cargo/general-freight/page/121)
- [Next page](https://specstream.ai/data/carriers/cargo/general-freight/page/123)
- [Page 1](https://specstream.ai/data/carriers/cargo/general-freight)

Source: [US Department of Transportation, FMCSA Motor Carrier Census, Inspection, Crash and Licensing files](https://data.transportation.gov/Trucking-and-Motorcoaches/Company-Census-File/az4n-8mr2). Public domain (U.S. government work). Inspection and crash counts cover November 10, 2024 to November 10, 2026. Fleet size, drivers, cargo and operation are as each carrier reports them to FMCSA and can be out of date. A vehicle or driver out of service order means an inspector ordered the vehicle or driver off the road until the problem was fixed. The national rate comes from every inspection in the same window. Crashes are those state police reported to FMCSA and are not a finding of fault. This page uses US Department of Transportation data and is not endorsed or certified by the Department of Transportation or FMCSA.

Free to reuse with credit to SpecStream under [CC BY 4.0](https://creativecommons.org/licenses/by/4.0/).